Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G35770-AT2G35780
Species:Arabidopsis
Duplication type:TD
Function (paralog1):serine carboxypeptidase-like 28
Function (paralog2):serine carboxypeptidase-like 26

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:5.0600274127491
Log2 mRNA fold difference:5.6369931411218
Log2 TE fold difference:-0.59150569569917
Sequences
Protein sequence

MMITKKLYQCMCLLCMVIALLDVVSSDDAKEQKMKDKIISLPGQPPNLNFSQFSGYVTVD
PAAGRALFYWLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNL
YAWNKVANVLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWLERFPEYKERAF
YIAGESYAGHYIPELAQLIVNRNKGAKNPTINLKGILMGNPLVDDYNDNKGMRDYWWNHG
LISDESYNDLTKWCLNDSILFPKLNCNAALNQALSEFGDIDPYNINSPACTTHASSNEWM
QAWRYRGNDECVVGYTRKYMNDPNVHKSFHARLNGSTPWTPCSRVIRKNWKDSPKSMLPI
IKNLLQAHLRIWIFSGDSDAVLPLSGTRHSINAMKLKSSKRWYPWYHSHGLVGGWSQVYE
DGLLTYTTVRAAGHEVPLSQPRLALFLFTHFLANHSLPSSPS

MARLLLLFFFFLILLHYASCSRHEQEKDRIFHLPGEPNDVSFSHFSGYITVNESAGRALF
YWLTESPPSENPESKPLVLWLNGGPGCSSVAYGAAEEIGPFRINPDGKTLYHNPYSWNKL
ANLLFLESPAGVGFSYSNTTSDLYTAGDQRTAEDAYVFLVKWFERFPQYKHREFYIAGES
YAGHYVPQLSQIVYEKRNPAINFKGFIVGNAVIDDYHDYVGLFEYWWAHGLISDLTYHNL
RITCEFGSSEHPSSKCTKAMEAADLEQGNIDPYSIYTVTCKKEAAALRSRFSRVRHPWMW
RAYDPCTEKYSGMYFNSPEVQKAMHANITGLAYPWKGCSDIVGEKWADSPLSMLPIYKEL
IAAGLRIWVFSGDTDSVVPITGTRYSIRALKLQPLSKWYPWNDDGQVGGWSQVYKGLTLV
TIHGAGHEVPLFRPRRAFLLFQSFLDNKPLPM

www.000webhost.com

Other information
Ka divergence:-0.243811KaKs divergence:-0.982268
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):1389Length 2 (bp):1359Length divergence:-0.011
MFE 1 (kcal):-426.61MFE 2 (kcal):-401.38MFE divergence-0.03