Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G35810-AT2G35820
Species:Arabidopsis
Duplication type:TD
Function (paralog1):
Function (paralog2):ureidoglycolate hydrolases

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.3999353869796
Log2 mRNA fold difference:-0.58207468222562
Log2 TE fold difference:-0.81187602188023
Sequences
Protein sequence

MQSSLSFSCGVKSTMAKSPVEVNLIPIEATPETFAEYGQVIEASRDGAGYGPNDAQLDLS
KGIPRLYILRLKETPLGFFKITHHAKVTQCLGSIGGDIWYMGVAKPSLIEDDDDGRRVDT
VKAKSGHLYIPPEVEEIRVFRFSGPKFVKLHRGTWHAGPLFSGSSIMDFYNLELSNTNVV
DHTSHDFTKNNGVSFRFDT

MAKSPVEVKLIPIEATPENFADYGQVIEASRDGAGFGPNDAQLDLSRGIPRFYIMRIRDT
PFDFSVLTHHASVTQCLGSIGGHVWYLGVAKPTLIEDGDDGKMVDKLKSRSGHLYAPPAV
EEIRVFRVSGPKFIKLNHGTWHVGPLFSDSYMDFYNLELSNTNAVDRTTYDFIKNKGVTI
RVDPNDVDTSSS

www.000webhost.com

Other information
Ka divergence:0.250143KaKs divergence:-0.565935
GC content 1 (%):45GC content 2 (%):48GC content divergence:0.032
Length 1 (bp):600Length 2 (bp):579Length divergence:-0.018
MFE 1 (kcal):-183.01MFE 2 (kcal):-165.9MFE divergence-0.049