Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G35840-AT3G52340
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Sucrose-6F-phosphate phosphohydrolase family protein
Function (paralog2):sucrose-6F-phosphate phosphohydrolase 2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.20627897997483
Log2 mRNA fold difference:-0.28480011466276
Log2 TE fold difference:0.0849071932114
Sequences
Protein sequence

MERLTSPPRLMIVSDLDHTMVDHHDPENLSLLRFNSLWEHAYRHDSLLVFSTGRSPTLYK
ELRKEKPLLTPDITIMSVGTEITYGNSMVPDHGWVEALNNKWDLGIVKQEASNFPELKLQ
AETEQRPHKVSFYVEKSKAQEVTKELSQRFLKRGLDVKIIYSGGMDLDILPQGAGKGQAL
AYLLKKLKTEGKLPVNTLACGDSGNDAELFSIPDVYGVMVSNAQEELLKWHAENAKDNPK
VIHAKERCAGGIIQAIGHFKLGPNLSPRDVSDFLEIKVENVNPGHEVVKFFLFYERWRRG
EVENSEAYTASLKASVHPGGVFVHPSGTEKSLRDTIDELRKYHGDKQGKKFRVWADQVLA
TDTTPGTWIVKLDKWEQDGDERRCCTTTVKFTSKEGEGLVWEHVQQTWSKETMVKDDSSW
II

MERLISHPPLMIVSDLDHTMVDHQDHENLSLLRFNSLWEYAYRRDSLLVFSTARSPVLYK
ELRKEKPLLTPDIIITSIGTEIAFGNSMVPDHAWVESLNSCKWNREIVLEETSKFPELTL
QPKTEQRLHKVSFYIDEGKGEALTKELSQLLEKRGLDVKIIYSWGKNVDVIPRGAGKGEA
LEYLLKKLQAEGIFPVNTLACGDSEHDAELFSIPDVHGVMVSNSQEELLKWRSENALNNL
KVIHSTERCADGIIQAIGHFNLGPDLSPRDVSEFLDRKMDNVNPGHEVVRFYLFYERLRR
GEIKNYETYIASFKDSCLHAAVLFHPSGAEKSLRDTIDELKKCYGDKRGKKFWVWVDQVL
VTDTIPGKWIVKFDKWEQCEDESQCCKTTVEFTSKGGDLVWEKVKQIWSEESKVKDDNSS
WIL

Other information
Ka divergence:0.464732KaKs divergence:0.806145
GC content 1 (%):44GC content 2 (%):42GC content divergence:-0.023
Length 1 (bp):1269Length 2 (bp):1272Length divergence:0.001
MFE 1 (kcal):-387.49MFE 2 (kcal):-379.43MFE divergence-0.011