Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G35850-AT3G52360
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:6.3756235775401
Log2 mRNA fold difference:2.9712084740451
Log2 TE fold difference:3.2854407928782
Sequences
Protein sequence

MESSIGFMTVFAVSGSVVLLAAQLHKRLLSGYMDKLEPPTKERKKKKKKVSFAEDMVEPS
GNNEEYRRSFRKSSKLEDER

MESSLGFMAVFAVSGSVVFLASQFHKRLLSDYMDKFEFEIRAQKKMVMKKKVRFAADVVE
PSGNNKEYRRRHSSKAKSNSKMAATI

Other information
Ka divergence:-0.531386KaKs divergence:-0.588579
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):243Length 2 (bp):261Length divergence:0.036
MFE 1 (kcal):-67.9MFE 2 (kcal):-73.35MFE divergence0.039