Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G35860-AT3G52370
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):FASCICLIN-like arabinogalactan protein 16 precursor
Function (paralog2):FASCICLIN-like arabinogalactan protein 15 precursor

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.4975180468164
Log2 mRNA fold difference:-1.514105636994
Log2 TE fold difference:0.024109524468309
Sequences
Protein sequence

MDSSYGATKFLLLLFLTTSIATALPDNKPVPGQINSNSVLVALLDSHYTELAELVEKALL
LQTLEEAVGKHNITIFAPRNDALERNLDPLFKSFLLEPRNLKSLQSLLMFHILPKRITSP
QWPSLSHHHRTLSNDHLHLTVDVNTLKVDSAEIIRPDDVIRPDGIIHGIERLLIPRSVQE
DFNRRRSLRSISAVIPEGAPEVDPRTHRLKKPSPAVPAGAPPVLPIYDAMSPGPSLAPAP
APGPGGPRGHFNGDAQVKDFIHTLLHYGGYNEMADILVNLTSLATEMGRLVSEGYVLTVL
APNDEAMAKLTTDQLSEPGAPEQIMYYHIIPEYQTEESMYNAVRRFGKVKYDSLRFPHKV
LAQEADGSVKFGHGDGSAYLFDPDIYTDGRISVQGIDGVLFPKEETPATEIKPAAPVVKK
VSKSRRGKLMEVACRMMGSRFIPCQ

MDDLSKLLFFLLLTISITTALPDKPGSGQINSNSVLVALLDSHYTELAELVEKALLLQTL
EEAVGQHNITIFAPRNDALEKNLDPEFKSFLLQPKNLKSLQSLLMFHILPKRITSPQFSS
AVVSHRTLSNDHLHFTNGKVNSAEITKPDDLTRPDGIIHGIERLLIPRSVQEDFNRRRSL
RSIAAVLPEGAPEVDPRTHRLKKKPAPIPAGAPPVLPVYDAMSPGPSLAPAPAPGPGGPR
HHFNGEAQVKDFIHTLLHYGGYNEMADILVNLTSLATEMGRLVSEGYVLTVLAPNDEAMA
KLTTDQLSEPGAPEQIMYYHIIPEYQTEESMYNSVRRFGKIRYDSLRFPHKVEAQEADGS
VKFGHGDGSAYLFDPDIYTDGRISVQGIDGVLFPEEKTPVEKKTGVPVVKKAPKPRRGKL
MEVACTMLGSQFPTCQ

www.000webhost.com

Other information
Ka divergence:0.172352KaKs divergence:0.94683
GC content 1 (%):48GC content 2 (%):46GC content divergence:-0.021
Length 1 (bp):1338Length 2 (bp):1311Length divergence:-0.01
MFE 1 (kcal):-358.57MFE 2 (kcal):-368.3MFE divergence0.013