Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G35930-AT3G52450
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):plant U-box 23
Function (paralog2):plant U-box 22

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.9944160410897
Log2 mRNA fold difference:-0.97752603294186
Log2 TE fold difference:-1.1555086554992
Sequences
Protein sequence

MSGGIMDEEIEIPPFFLCPISLEIMKDPVIVSTGITYDRDSIEKWLFAGKKNSCPVTKQD
ITDADLTPNHTLRRLIQSWCTLNASYGVERIPTPRPPICKSEIEKLIRDSASSHENQVKC
LKRLRQIVSENATNKRCLEAAGVPEFLANIVSNDSENGSLTDEALNLLYHLETSETVLKN
LLNNKKDNNIVKSLTKIMQRGMYESRVYATLLLKNILEVADPMQSMTLKPEVFTEVVQIL
DDRISQKATKAAMHILVNICPWGRNRHKAVEAGVISVIIELLMDESFTSERRGPEMAMVV
LDLLCQCAEGRAEFLNHGAAIAVVCKKILRVSQTASDRAVRVLLSVGRFCATPALLHEML
QLGVVAKLCLVLQVSCGGKTKEKAKELLKLHARVWKDSPCLPKNMILAYPC

MDQEIEIPSFFLCPISLDIMKDPVIVSTGITYDRESIEKWLFSGKKNSCPVTKQVITETD
LTPNHTLRRLIQSWCTLNASYGIERIPTPKPPICKSEIEKLIKESSSSHLNQVKCLKRLR
QIVSENTTNKRCLEAAEVPEFLANIVSNSVDTYNSPSSSLSSSNLNDMCQSNMLENRFDS
SRSLMDEALSVLYHLDTSETALKSLLNNKKGTNLVKTLTKIMQRGIYESRAYAALLLKKL
LEVADPMQIILLERELFGEVIQILHDQISHKATRSAMQILVITCPWGRNRHKAVEGGTIS
MIIELLMDDTFSSERRNSEMAMVVLDMLCQCAEGRAEFLNHGAAIAVVSKKILRVSQITS
ERAVRVLLSVGRFCATPSLLQEMLQLGVVAKLCLVLQVSCGNKTKEKAKELLKLHARVWR
ESPCVPRNLYDSYPA

www.000webhost.com

Other information
Ka divergence:0.184235KaKs divergence:0.0817757
GC content 1 (%):49GC content 2 (%):43GC content divergence:-0.065
Length 1 (bp):1236Length 2 (bp):1308Length divergence:0.028
MFE 1 (kcal):-391.7MFE 2 (kcal):-381.55MFE divergence-0.013