Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G36050-AT3G52540
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ovate family protein 15
Function (paralog2):ovate family protein 18

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:2.5051158237256
Log2 mRNA fold difference:-1.9737911648973
Log2 TE fold difference:4.487122020717
Sequences
Protein sequence

MKLPFLNKNHSTSSYSSNSSSSSWPWPSCNQNPKTLSFRATITFTNPIHDQDDDELDLLD
PPEITDSVENVIKGLRSSERLIFESKGETNSILEEATSKREEEDEEEGFMLFSLESDDPY
SDFKRSMEEMVEAHALHHDWKSLEKLLLQFLKVNAKTSHRYIFAAFVDLLMNLALDTKKA
IINNDISKDDGVSASRAAAAGEASTSCCNSMTLGESPSSPLSFYTSCSSSSSSDETSSMS
VRFLPLSSLLEMDEKTKEILV

MVRKMKLPFLNKNTSSSSFSSNSSSSSSSWPWPSSHQQNLKTISSKASFIVNKPKDVYEP
EPPPRSFSSSPSSSSYSSFSSTSHAIENPPEIESIENVIKGLKSSKRLIFERRGTSNSIL
EEATKRDDHEEEEDGLMLLSLESNDPYTDFKNSMEKMVEVHVLHHDWISLEKLLFWFLKV
NVKASHRYIFAAFVDLVLNLAVGPSKDVAGEPNSDVVVEDSLSSSWPVSLYSSSDENSST
SVRFLPETSIGEKGRDVCCLSSLFELEEKIKDNIDPNDYVSS

www.000webhost.com

Other information
Ka divergence:0.339999KaKs divergence:-0.480426
GC content 1 (%):46GC content 2 (%):42GC content divergence:-0.045
Length 1 (bp):786Length 2 (bp):849Length divergence:0.039
MFE 1 (kcal):-209.98MFE 2 (kcal):-221.1MFE divergence0.026