Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G36060-AT3G52560
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):MMS ZWEI homologue 3
Function (paralog2):ubiquitin E2 variant 1D-4

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.33597892562211
Log2 mRNA fold difference:0.11035531474559
Log2 TE fold difference:0.23429249259302
Sequences
Protein sequence

MTLGSGSSVVVPRNFRLLEELERGEKGIGDGTVSYGMDDGDDIYMRSWTGTIIGPHNVTV
HEGRIYQLKLFCDKDYPEKPPTVRFHSRINMTCVNHDTGVVDSKKFGVLANWQRQYTMED
ILTQLKKEMAASHNRKLVQPPEGTFF

MTLGSGGSSVVVPRNFRLLEELERGEKGIGDGTVSYGMDDGDDIYMRSWTGTIIGPHNIM
PLLLLLVVTEINFMSQTVHEGRIYQLKLFCDKDYPEKPPTVRFHSRVNMACVNHETGVVD
PKKFGLLANWQREYTMEDILVQLKKEMSTSHNRKLVQPPEGTCF

Other information
Ka divergence:0.111685KaKs divergence:-0.282658
GC content 1 (%):46GC content 2 (%):44GC content divergence:-0.022
Length 1 (bp):441Length 2 (bp):495Length divergence:0.058
MFE 1 (kcal):-122.5MFE 2 (kcal):-145.8MFE divergence0.087