Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G36160-AT3G52580
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ribosomal protein S11 family protein
Function (paralog2):Ribosomal protein S11 family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.5650221037623
Log2 mRNA fold difference:-1.323361934233
Log2 TE fold difference:-0.20555308237405
Sequences
Protein sequence

MSKRKTKEPKVDVVTLGPSVREGEQVFGVVHIFASFNDTFIHVTDLSGRETLVRITGGMK
VKADRDESSPYAAMLAAQDVAQRCKELGITAMHVKLRATGGNKTKTPGPGAQSALRALAR
SGMKIGRIEDVTPIPTDSTRRKGGRRGRRL

MSKRKTKEPKVENVTLGPAVREGEQVFGVVHVFASFNDTFIHVTDLSGRETLVRITGGMK
VKADRDESSPYAAMLAAQDVAQRCKELGITAIHVKLRATGGNKTKTPGPGAQSALRALAR
SGMKIGRIEDVTPIPTDSTRRKGGRRGRRL

Other information
Ka divergence:-0.454438KaKs divergence:0.999943
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):453Length 2 (bp):453Length divergence:0
MFE 1 (kcal):-144.4MFE 2 (kcal):-145.2MFE divergence0.003