Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G36170-AT3G52590
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ubiquitin supergroup;Ribosomal protein L40e
Function (paralog2):ubiquitin extension protein 1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:2.1216789256212
Log2 mRNA fold difference:1.2957833569471
Log2 TE fold difference:0.86572860130902
Sequences
Protein sequence

MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGIIEPSLMMLARKYNQDKMICRKCYARLHPRAVNCRKKKCGHSNQ
LRPKKKIK

MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGIIEPSLMMLARKYNQDKMICRKCYARLHPRAVNCRKKKCGHSNQ
LRPKKKIK

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):387Length 2 (bp):387Length divergence:0
MFE 1 (kcal):-117.6MFE 2 (kcal):-128.2MFE divergence0.043