Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G36220-AT3G52710
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.3340615629178
Log2 mRNA fold difference:-1.0719915985445
Log2 TE fold difference:-0.27372035917332
Sequences
Protein sequence

MPQVDIEAFVSSVCIGGSDHRKIVCETLADDSTIPPYYNNSAVSPSDFPPESYFLSNDAQ
LEWLSDNAFFDRKDSQKGNSGILNSNPNSNPSSQRFLLKSKASIIGLPKPQKTCFNEAKQ
RRHAGKNRVILKRVGSRIKTDISLLEPSSPKVSCIGRVRSRRERSRRMHRQKSSRVEPVN
RVKKPGFMASFRAIFRIKGGCKDVSARETHTSTRNTHDIRSRLPAEADEKSVFDGGEPVV
PGLGGMTRFASGRRADLLGGGGC

MPQVVASACTGGSDRKISCETLADDNEDSPHNSKIRPVSISAVDFPPESYSLSKEAQLEW
LNDNAFFERKESQKGNSSAPISNPNTNPNSSSHRISLKSKASIIRLPKPQKTCFNEAKKR
RNCRIARTLMIPKRIGSRLKSDPTLSEPCSPKVSCIGRVRSKRDRSRRMQRQKSGRTNSF
KDKPVPVKKPGFFASFRAIFRTGGGCKDLSASGAHAPRRDVVVSPPRVSVRRSTDIRGRL
PPGDVGKSSPQRNSTGSRRSIDGGEPVLPGLGGMTRFTSGRRPDLLVEV

www.000webhost.com

Other information
Ka divergence:-0.267317KaKs divergence:-0.391463
GC content 1 (%):50GC content 2 (%):48GC content divergence:-0.02
Length 1 (bp):792Length 2 (bp):870Length divergence:0.047
MFE 1 (kcal):-277.59MFE 2 (kcal):-284.4MFE divergence0.012