Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G36250-AT3G52750
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Tubulin/FtsZ family protein
Function (paralog2):Tubulin/FtsZ family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.82914209010234
Log2 mRNA fold difference:-1.8090935394095
Log2 TE fold difference:0.97468505000124
Sequences
Protein sequence

MATYVSPCFTPSDSRLLTVLRKNVLPENHLGRLNSIRTIDSKKNRVVVAAQKSESSPIRN
SPRHYQSQAQDPFLNLHPEISMLRGEGTSTIVNPRKETSSGPVVEDFEEPSAPSNYNEAR
IKVIGVGGGGSNAVNRMIESEMSGVEFWIVNTDIQAMRMSPVLPDNRLQIGKELTRGLGA
GGNPEIGMNAARESKEVIEEALYGSDMVFVTAGMGGGTGTGAAPVIAGIAKAMGILTVGI
ATTPFSFEGRRRTVQAQEGLASLRDNVDTLIVIPNDKLLTAVSQSTPVTEAFNLADDILR
QGVRGISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKSRARDAALNAIQSPLLD
IGIERATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVVDPALSGQVSITLI
ATGFKRQEEGEGRTVQMVQADAASVGATRRPSSSFRESGSVEIPEFLKKKGSSRYPRV

MAAYVSPCLTPPDSRVLTVLRKSVLPDHHLGTRVGCLRMSEGTTKRYRVVASHKYESSSI
RNSLNSHSTSHFQSQDSFLNLHPEISMLNPRKETSSVPITEDLDELSTPNTYNEARIKVI
GVGGGGSNAVNRMIESEMIGVEFWIVNTDIQAMRISPVFPDNRLQIGKELTRGLGAGGNP
EIGMNAATESKEAIQEALYGSDMVFVTAGMGGGTGTGGAPIIAGVAKAMGILTVGIVTTP
FSFEGRRRALQAQEGIAALRDNVDTLIVIPNDKLLAAVSQSTPVTEAFNLADDILRQGVR
GISDIITIPGLVNVDFADVRAIMANAGSSLMGIGTATGKTRARDAALNAIQSPLLDIGIE
RATGIVWNITGGSDLTLFEVNAAAEVIYDLVDPTANLIFGAVVDPSYSGQISITLIATGF
KRQEEGEGRPLQATQADASMGATRRPSSSFTEGSSIEIPEFLKKKGRSRYPRL

www.000webhost.com

Other information
Ka divergence:-0.20955KaKs divergence:-0.342967
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1437Length 2 (bp):1422Length divergence:-0.005
MFE 1 (kcal):-443.34MFE 2 (kcal):-418MFE divergence-0.029