Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G36300-AT3G52760
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Integral membrane Yip1 family protein
Function (paralog2):Integral membrane Yip1 family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.40498609725684
Log2 mRNA fold difference:-0.47522741966935
Log2 TE fold difference:0.073959796659578
Sequences
Protein sequence

MTKDFAVPPVVFPSGGSSGGANVQQRRFPATPFQPPRPSSSAIPFMSFDIGSAAASSATP
AGPFGGTIASSSSFGGGSASFEDEEPLLDELGIHPDQIWKKTRSILNPFRINQAVHKDSD
LSGPIFLYLALCLFQLLAGKIQFGVILGWIVVSSIFLYVVFNMLAGRNGNLNLHTCTSLV
GYCLLPVVVLSAVSLFVPQGAGPVRFVLAALFVLWSTRACSTLVVSLADGGEEHRGLIAY
ACFLIYTLFSLLVIF

MTKDFPIPPVVFPTSGSSPATANVQQRRVPTAPYQPPRQSSASSSIPFIPFEIGSAAVSM
PAGPFDGTIASSASFGRGVSASFEDEEPLLDELGIHPDQIWKKTRSILNPFRINQTVHKD
SDLSGPIFLYLALCLFQLLAGKIQFGVILGWVVVSSIFLYIVFNMLAGRNGNLNLHTCTS
LVGYSLLPVVILSAVSLFVPQGAGPVRFVLGAAFVLWATRACSNLVVSLADGGEEHRGLI
SYACFLIYTLFSLLVIF

www.000webhost.com

Other information
Ka divergence:0.36285KaKs divergence:0.086728
GC content 1 (%):48GC content 2 (%):46GC content divergence:-0.021
Length 1 (bp):768Length 2 (bp):774Length divergence:0.004
MFE 1 (kcal):-245.2MFE 2 (kcal):-225.05MFE divergence-0.043