Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G36320-AT3G52800
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):A20/AN1-like zinc finger family protein
Function (paralog2):A20/AN1-like zinc finger family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.7840603426695
Log2 mRNA fold difference:0.86851035653068
Log2 TE fold difference:0.92931220014305
Sequences
Protein sequence

MAEEHRCETPEGHRLCVNNCGFFGSSATMNLCSNCYGDLCLKQQQQASMKSTVESSLSPV
IAPVLENYAAELEIPTTKKTEEKKPIQIPTEQPSPPQRPNRCTVCRKRVGLTGFMCRCGT
TFCGSHRYPEVHGCTFDFKSAGREEIAKANPLVIAAKLQKI

MAEEHRCQTPESNRLCVNNCGFLGSSATMNLCSNCYGDLCLKQQQQSSSIKSTVESSLSV
SPPSSSSSEISSPIIPPLLKNPSVKLEVPEKKAVISLPTTEQNQQQRPNRCTTCRKRVGL
TGFKCRCGTMFCGVHRYPEIHGCSYDFKSAGREEIAKANPLVKAAKLQKI

Other information
Ka divergence:0.213155KaKs divergence:0.617516
GC content 1 (%):50GC content 2 (%):51GC content divergence:0.01
Length 1 (bp):486Length 2 (bp):513Length divergence:0.027
MFE 1 (kcal):-154.6MFE 2 (kcal):-166.2MFE divergence0.036