Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G36350-AT3G52890
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):KCBP-interacting protein kinase

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.84815938869077
Log2 mRNA fold difference:0.72696231270259
Log2 TE fold difference:0.11503967193521
Sequences
Protein sequence

MESFAGSCEIVEEKDAVRLAKHSSRYCMSPLGSSKDMEQRPALKSGYQGSMEYDIDQLFQ
SITIKPSPRRVMGSSFHHLETSASAGTSRSTSPSNKGAMKKPFPMGTPRSPRVGPSDSIS
LKQALRDLCISKASEMASQKRLSKSAAASPRVSEADRIKTLYRQVLNESAGKPGLPVDKG
KSLVEISLTPVVDIPSSSQSVPQRYDVLETEPSNFISEPSQAEILLHVLGNGSGIKTVGY
GMLETVSLCKSNKSGSCLSSGSGDYEIEIDENHTSPPHMVIEDQLVEIDKHVTSLPSCSG
SKVDTEELDKSIVSSARVKSEPTALSSGLKGKLDNFPGSGTEKSKLVSKVTRNIPRPKPR
PKKKILLKKKLKIVVNSATKMVEEVDTSLEPSASQLLCQKCHCAVKSTSTENHPPSNTSH
TTDKNVSIEADQESLASPRLIRIVKCNKEASKGSSDSCEVSDSGEAVIVMKQEVSPSNYS
GKGDADEQIRANPTSSEKFDFSLSSKNSLGDYSSSTSMSEESNLSRFSCGNKPHMSMDVR
WEAVKHVKLQYGSLGLRHFNLLKKLGCGDIGTVYLAELVGTNCLFAIKVMDNEFLARRKK
TPRAQAERAILKMLDHPFLPTLYAQFTSDNLSCLVMEYCPGGDLHVLRQKQLSRCFSEPA
TRFYVAEILLALEYLHMLGVIYRDLKPENILVREDGHIMLTDFDLSLRCAVNPTLLRSTS
PPEKDPARMSGPYSTSNCIQPLCIEPSCRVPCFSPRLLSTQARNQKPRKPKRPDLLTQQF
RSLPQLVAEPTEARSNSFVGTHEYLAPEIIKGEGHGAAVDWWTFGVLLYELLYGKTPFKG
YDNEETLSNVVYQNLKFPDSPLVSFQAKELIRRLLVKDPESRLGSEKGAAEIKRHPFFEG
LNWALIRCAIPPELPDIYDNGATEATSPEGNNRYLECKAIGDHLEFELF

MGSFAGACEIVEEKDDEVRLPKHSGRYGKSVMGSSSKDLVERKQREYHGSLEYDIDMLFQ
SISVKPSTTRLMSSSFHHHETSASAGPSRTTSPSKRIASMKKPGTPQSPRFVGLSDSVSL
KQALRDRCISKASEMAAQKRLSKSAAASPRVSEADRIKSLYNQVSNESTSSRSGLVPVDK
GKGSLVEIPLMPVNDKPSSSKSVPQRFEDPSNPISEPSQAGTSFGLQGVGNQTREIKLLH
RSNKPGSCLSSGSGDYEIELDENVASPSTHAFVEDDVIEIDKHVTSLPSHSSKKVNATEL
DKNISSSAVDSEQKGKLDDAPNSGTENGKTVRKVTRMIPRPKQPKKKILLKKKLKIGVVS
ATYPTKDDEEIVPSLDSSANQLLCQRCHCSLKSTSIDDNPPSYTSSHNPKICTDSLSSVS
NKEAHQGSDENSSGSCNVSQSSEADIVIMKQDVSSSNNSGIGAMVEKETENPTSSEKFEF
SLSSKDSLGDYSRSTSISEESNLSRFSCGNKPHMSMDVRWEAIKHIKVQYGSLGLRHFNL
LKKLGCGDIGTVYLAELIGTNCLFAIKVMDNEFLARRKKSPRAQAEREILKMLDHPFLPT
LYAQFTSDNLSCLVMEYCPGGDLHVLRQKQLGRCFPEPAARFYVAEILLALEYLHMLGII
YRDLKPENILVREDGHIMLTDFDLSLRCAVNPTLVRSNSPPGKDPARISGPYNTSNCIQP
FCITEPSCQVSCFSPRLSSNQQQGRKPKRGDHLSKTQQHLSRSLPQLVAEPTEARSNSFV
GTHEYLAPEIIKGEGHGAAVDWWTFGVLLYELLYGKTPFKGYNNDETLANVVLQNLKFPD
SPLVSFQAKDLIRGLLVKEPENRLGSEKGSVEIKRHPFFEGLNWALIRCAIPPELPDFYE
YGGGPEAAADSPGGSNNRYLECKAIGDHLEFELF

www.000webhost.com

Other information
Ka divergence:0.0118402KaKs divergence:-0.458965
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):2850Length 2 (bp):2805Length divergence:-0.008
MFE 1 (kcal):-897.34MFE 2 (kcal):-868.43MFE divergence-0.016