Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G36400-AT3G52910
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):growth-regulating factor 3
Function (paralog2):growth-regulating factor 4

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.39620317464454
Log2 mRNA fold difference:0.20953061478732
Log2 TE fold difference:0.20821290097843
Sequences
Protein sequence

MDLQLKQWRSQQQQQHQTESEEQPSAAKIPKHVFDQIHSHTATSTALPLFTPEPTSSKLS
SLSPDSSSRFPKMGSFFSWAQWQELELQALIYRYMLAGAAVPQELLLPIKKSLLHLSPSY
FLHHPLQHLPHYQPAWYLGRAAMDPEPGRCRRTDGKKWRCSRDVFAGHKYCERHMHRGRN
RSRKPVETPTTVNATATSMASSVAAAATTTTATTTSTFAFGGGGGSEEVVGQGGSFFFSG
SSNSSSELLHLSQSCSEMKQESNNMNNKRPYESHIGFSNNRSDGGHILRPFFDDWPRSSL
QEADNSSSPMSSATCLSISMPGNSSSDVSLKLSTGNEEGARSNNNGRDQQNMSWWSGGGS
NHHHHNMGGPLAEALRSSSSSSPTSVLHQLGVSTQAFH

MDLQLKQWRSQQQNESEEQGSAATKISNFFFDQIQSQTATSAAAAPLPLFVPEPTSSSSF
SCFSPDSSNSSSSSRFLKMGNFFSWAQWQELELQALIYRYMLAGASVPQELLLPIKKSLL
HQSPMHFLHHPLQHSFPHHQPSWYWGRGAMDPEPGRCKRTDGKKWRCSRDVVAGHKYCDR
HIHRGRNRSRKPVETATTTITTTATTTASSFVLGEELGHGPNNNHFFSSGSSQPLHLSHQ
QSCSSEMKQESNNNKRPYEANSGFSNGRSDDGHILRHFFDDWPRSSDSTSSPMSSSTCHL
SISMPGNNTSSDVSLKLSTGNEEEEENMRNNNNEREQMNWWSNGGNHHNNMGGPLAEALR
SASSTSSVLHQMGISTQVFH

www.000webhost.com

Other information
Ka divergence:0.339904KaKs divergence:0.465418
GC content 1 (%):49GC content 2 (%):44GC content divergence:-0.054
Length 1 (bp):1197Length 2 (bp):1143Length divergence:-0.023
MFE 1 (kcal):-400.52MFE 2 (kcal):-332.88MFE divergence-0.092