Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G36460-AT3G52930
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Aldolase superfamily protein
Function (paralog2):Aldolase superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.6108856420753
Log2 mRNA fold difference:1.3961442791569
Log2 TE fold difference:1.3673395962595
Sequences
Protein sequence

MSSFTSKFADELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVESNRRALRELLF
TTPGALPCLSGVILFEETLYQKSSDGTPFVDMLKSAGVLPGIKVDKGTVELAGTNGETTT
QGLDGLGDRCKKYYEAGARFAKWRAVLKIGVNEPSQLAIHENAYGLARYAVICQENGLVP
IVEPEILVDGSHDIQKCAAVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSESAKVAP
EVIAEHTVRALQRTVPAAVPAIVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRAL
QQSTLKTWGGKEENVKKAQEAFLVRCKANSEATLGAYKGDAKLGEGAAESLHVKDYKY

MSAFTSKFADELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVETNRRNLRELLF
TAPGALPCLSGVILFEETLYQKSSDGKLFVDILKEGGVLPGIKVDKGTVELAGTDGETTT
QGLDGLGDRCKKYYEAGARFAKWRAVLKIGENEPSEHSIHENAYGLARYAVICQENGLVP
IVEPEILVDGSHDIQKCAAVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSDSPKVSP
EVIAEHTVRALQRTVPAAVPAIVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRAL
QQSTLKTWAGKEENVKAAQEALYVRCKANSEATLGTYKGDAKLGDGAAESLHVKDYKY

Other information
Ka divergence:0.168343KaKs divergence:0.0257038
GC content 1 (%):48GC content 2 (%):51GC content divergence:0.03
Length 1 (bp):1077Length 2 (bp):1077Length divergence:0
MFE 1 (kcal):-376.2MFE 2 (kcal):-367.5MFE divergence-0.012