Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G36500-AT3G52950
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):CBS / octicosapeptide/Phox/Bemp1 (PB1) domains-containing protein
Function (paralog2):CBS / octicosapeptide/Phox/Bemp1 (PB1) domains-containing protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:2.9014512579898
Log2 mRNA fold difference:3.3419346643018
Log2 TE fold difference:-0.50150776859876
Sequences
Protein sequence

MTTTPTSSGRRSISSIRRTSSASKKPVLQSEESESGSGSINENTSKPDSPLAQPVSDGER
TVKKLRLSKALTINEGTTVFDACRRMAARRVDAVLLTDSSALLSGIVTDKDIATRVIAEG
LRPEHTLVSKVMTRNPIFVTSDSLAIEALQKMVQGKFRHLPVVENGEVIALLDITKCLYD
AISRMEKAAEQGSALATAVEERHWGSGNFAFIDTLRERMFKPALSTIVTENTKVALVSAS
DPVFVASKKMRDLRVNSVIIAVGNKIHGILTSKDILMRVVAQNLSPELTLVEKVMTPNPE
CASIETTILDALHIMHDGKFLHLPVFDKDGFAVACLDVLQITHAAISTVENNSSGAVNDM
ANTMMQKFWDSALALEPPEDYETHSDMSAMLINSEGKQSCPSQGLVSSFAFKFEDRKGRV
QRFNSTGESFEELMSVVMQRCEADSGLQIMYQDDEGDKVLISRDSDLVAAVTFARSLGQK
VLRLHLDFTETIAPLETIADLSEGNGGCVWWQTGVLAGAIVLTSIGLFVYLKRSKK

MSTQATGPSSTSGRRSNSTVRRGPPPSKKPVQSENGSVNGNTSKPNSPPPQPQSQAPSNG
ERTVKKLRLSKALTIPEGTTVFDACRRMAARRVDACLLTDSSALLSGIVTDKDVATRVIA
EGLRPDQTLVSKVMTRNPIFVTSDSLALEALQKMVQGKFRHLPVVENGEVIALLDITKCL
YDAISRMEKAAEQGSALAAAVEGVEKQWGSGYSAPYAFIETLRERMFKPALSTIITDNSK
VALVAPSDPVSVAAKRMRDLRVNSVIISTGNKISGILTSKDILMRVVAQNLSPELTLVEK
VMTPNPECASLETTILDALHTMHDGKFLHLPIIDKDGSAAACVDVLQITHAAISMVENSS
GAVNDMANTMMQKFWDSALALEPPDDSDTQSEMSAMMHHSDIGKLSSYPSLGLGNSFSFK
FEDLKGRVHRFTSGAENLEELMGIVMQRIGSDNNNVEQRPQIIYEDDEGDKVLITSDSDL
VGAVTLARSTGQKVLRLHLDFTESTRSLSSETTQLKKGDSRDRGSGWVSWRGGVVVTGAV
VLTSIAIVVYLKRSKN

Other information
Ka divergence:-0.134883KaKs divergence:-0.159381
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1611Length 2 (bp):1671Length divergence:0.018
MFE 1 (kcal):-503.3MFE 2 (kcal):-513.24MFE divergence0.01