Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G36580-AT3G52990
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Pyruvate kinase family protein
Function (paralog2):Pyruvate kinase family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.5197292531627
Log2 mRNA fold difference:1.4565275092876
Log2 TE fold difference:0.13522490559451
Sequences
Protein sequence

MHSSHLLLEEPIRMTSILEPSKSSFFPALTKIVGTLGPKSRSVEVIAGCLKAGMSVARFD
FSWCDADYHQETLENLKIAVKSTKKLCAVMLDTVGPELQVINKTEKAISLKADGLVTLTP
SQDQEASSEVLPINFDGLAKAVKKGDTIFVGQYLFTGSETTSVWLEVEEVKGDDVICISR
NAATLGGPLFTLHVSQVHIDMPTLTEKDKEVISTWGVQNKIDFLSLSYCRHAEDVRQARE
LLNSCGDLSQTQIFAKIENEEGLTHFDEILQEADGIILSRGNLGIDLPPEKVFLFQKAAL
YKCNMAGKPAVLTRVVDSMTDNLRPTRAEATDVANAVLDGSDAILLGAETLRGLYPVETI
STVGRICCEAEKVFNQDLFFKKTVKYVGEPMTHLESIASSAVRAAIKVKASVIICFTSSG
RAARLIAKYRPTMPVLSVVIPRLTTNQLKWSFSGAFEARQSLIVRGLFPMLADPRHPAES
TSATNESVLKVALDHGKQAGVIKSHDRVVVCQKVGDASVVKIIELED

MHSSHLLLEEPIRMASILEPSKSSFFPALTKIVGTLGPKSRSVEALSGCLKAGMSVARFD
FSWGDADYHQETLDNLKVAVRSTKKLCAVMLDTVGPELQVINKSEKAITLKADGLVTLTP
NQDQEASSEVLPINFNGLAKAVKKGDTIFVGQYLFTGSETTSVWLEVDEVKGDDVICLSR
NAATLAGSLFTLHSSQVHIDLPTLTEKDKEVISTWGVQNKIDFLSLSYCRHAEDVRQTRE
MLKKLGDLSQTQIFAKIENVEGLTHFDEILQEADGIILSRGNLGIDLPPEKVFLFQKAAL
YKCNMAGKPAVLTRVVDSMTDNLRPTRAEATDVANAVLDGSDAILLGAETLRGLYPVETI
STVGRICAEAEKVFNQDLYFKKTVKYVGEPMTHLESIASSAVRAAIKVKASVIICFTSSG
RAARLIAKYRPTMPVISVVIPRVKTNQLKWSFSGAFEARQSLIVRGLFPMLADPRHPAES
TSATNESVLKVALDHGKHAGVIKSHDRVVVCQKVGDASVVKIIELED

Other information
Ka divergence:-0.247759KaKs divergence:-0.43928
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1584Length 2 (bp):1584Length divergence:0
MFE 1 (kcal):-485.61MFE 2 (kcal):-484.86MFE divergence-0.001