Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G36640-AT3G53040
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):embryonic cell protein 63
Function (paralog2):late embryogenesis abundant protein, putative / LEA protein, putative

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.43895688816845
Log2 mRNA fold difference:0.67425665213016
Log2 TE fold difference:-0.33206922811814
Sequences
Protein sequence

MASDKQKAERAEVAARLAAEDLHDINKSGGADVTMYKVTERTTEHPPEQDRPGVIGSVFR
AVQGTYEHARDAVVGKTHEAAESTKEGAQIASEKAVGAKDATVEKAKETADYTAEKVGEY
KDYTVDKAKEAKDTTAEKAKETANYTADKAVEAKDKTAEKIGEYKDYAVDKAVEAKDKTA
EKAKETANYTADKAKEAKDKTAEKVGEYKDYTVDKAVEARDYTAEKAIEAKDKTAEKTGE
YKDYTVEKATEGKDVTVSKLGELKDSAVETAKRAMGFLSGKTEEAKGKAVETKDTAKENM
EKAGEVTRQKMEEMRLEGKELKEEAGAKAQEASQKTRESTESGAQKAEETKDSAAVRGNE
AKGTIFGALGNVTEAIKSKLTMPSDIVEETRAAREHGGTGRTVVEVKVEDSKPGKVATSL
KASDQMTGQTFNDVGRMDDDARKDKGKL

MASGQREAERSAKAERAEAAASLAAEDLKDINKGDVTYKLTERTTTTEPERPGLIGSVMK
AVQGTKDAVIGKSHDTAESTREGADIASEKAAGMRDTTGEVRDSTAQKTKETADYTADKA
REAKDKTADKTKETADYAAEKAREAKDRTADKTKETAEYTAEKAREAKDKTADKLGEYKD
YTAEKAKEAKDTTAEKLGEYKDYTVDKAKEAKDKTAEKAKETAEYTSDKARETKDKTAEK
VGEYKDYTAEKAKETADKAREAKDKTAEKVGEYRDYTAEKATETKDAGVSKIGELKDSAV
DTAKRAMGFLSGKTEETKQKAVETKDTAKEKMDEAGEEARRKMEEMRLEGKKLDEDASRK
TQQSTESAADKAHETKDSVAQRGEEGKGSIMGALGNMTGAIKSKLTGATTPSDEETRASA
HGDESTGKTVVAVDVKDTRPGYVATVLKEADQMTGQTFNDVGEIDDEEKVRIVVGEKKL

www.000webhost.com

Other information
Ka divergence:-0.010291KaKs divergence:0.254355
GC content 1 (%):49GC content 2 (%):50GC content divergence:0.01
Length 1 (bp):1347Length 2 (bp):1440Length divergence:0.033
MFE 1 (kcal):-371.97MFE 2 (kcal):-376.63MFE divergence0.006