Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G36680-AT3G53120
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Modifier of rudimentary (Mod(r)) protein
Function (paralog2):Modifier of rudimentary (Mod(r)) protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.78631054931939
Log2 mRNA fold difference:-0.91772171631107
Log2 TE fold difference:0.065234489705222
Sequences
Protein sequence

MFNFWGSKEQQQGQSRPSPEASATPWYSPSLVTSPSSSRPQTSGQIPSHVSPGEAAGIIA
ILKDKSVDELRKLLSDKDAYQQFLHSLDQVTIQNNIREELRKETLHLARENLEKEPQIVE
LRNQCRIIRTSELATAQEKLNELENQREEILKFYSPGSLLHRLQDAMNQVDEESEELQQK
FMEKDIDTAAFVQKYKKLRSKYHRRALIHLAAKTSSIG

MFNFWGSKDQQQGQSRPQEASSQSPWYSPSLVSSPSSSRPQSSGQISAQVSPGEAAGIIV
FLKDKSVDELRKLLSDKDAYQQFLLSLDQVKVQNNIKDELRRETLQLARDNLEKEPQIME
LRNQCRIIRTTELATAQEKLNELERQKEEILKFYSPGSLLHKLQEAMNQVDEESEALQEK
FLEKEIDTAAFVQKYKKLRTTYHRRALIHLAAKTSNI

Other information
Ka divergence:-0.354466KaKs divergence:-0.110583
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):657Length 2 (bp):654Length divergence:-0.002
MFE 1 (kcal):-186.06MFE 2 (kcal):-180.83MFE divergence-0.014