Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G36750-AT2G36760
Species:Arabidopsis
Duplication type:TD
Function (paralog1):UDP-glucosyl transferase 73C1
Function (paralog2):UDP-glucosyl transferase 73C2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.65933745092009
Log2 mRNA fold difference:0.85437489737066
Log2 TE fold difference:-0.032298962885636
Sequences
Protein sequence

MASEFRPPLHFVLFPFMAQGHMIPMVDIARLLAQRGVTITIVTTPQNAGRFKNVLSRAIQ
SGLPINLVQVKFPSQESGSPEGQENLDLLDSLGASLTFFKAFSLLEEPVEKLLKEIQPRP
NCIIADMCLPYTNRIAKNLGIPKIIFHGMCCFNLLCTHIMHQNHEFLETIESDKEYFPIP
NFPDRVEFTKSQLPMVLVAGDWKDFLDGMTEGDNTSYGVIVNTFEELEPAYVRDYKKVKA
GKIWSIGPVSLCNKLGEDQAERGNKADIDQDECIKWLDSKEEGSVLYVCLGSICNLPLSQ
LKELGLGLEESQRPFIWVIRGWEKYNELLEWISESGYKERIKERGLLITGWSPQMLILTH
PAVGGFLTHCGWNSTLEGITSGVPLLTWPLFGDQFCNEKLAVQILKAGVRAGVEESMRWG
EEEKIGVLVDKEGVKKAVEELMGDSNDAKERRKRVKELGELAHKAVEEGGSSHSNITFLL
QDIMQLEQPKK

MAFEKTRQFLPPLHFVLFPFMAQGHMIPMVDIARILAQRGVTITIVTTPHNAARFKDVLN
RAIQSGLHIRVEHVKFPFQEAGLQEGQENVDFLDSMELMVHFFKAVNMLENPVMKLMEEM
KPKPSCLISDFCLPYTSKIAKRFNIPKIVFHGVSCFCLLSMHILHRNHNILHALKSDKEY
FLVPSFPDRVEFTKLQVTVKTNFSGDWKEIMDEQVDADDTSYGVIVNTFQDLESAYVKNY
TEARAGKVWSIGPVSLCNKVGEDKAERGNKAAIDQDECIKWLDSKDVESVLYVCLGSICN
LPLAQLRELGLGLEATKRPFIWVIRGGGKYHELAEWILESGFEERTKERSLLIKGWSPQM
LILSHPAVGGFLTHCGWNSTLEGITSGVPLITWPLFGDQFCNQKLIVQVLKAGVSVGVEE
VMKWGEEESIGVLVDKEGVKKAVDEIMGESDEAKERRKRVRELGELAHKAVEEGGSSHSN
IIFLLQDIMQQVESKS

Other information
Ka divergence:0.054671KaKs divergence:0.652682
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):1476Length 2 (bp):1491Length divergence:0.005
MFE 1 (kcal):-448.61MFE 2 (kcal):-452.43MFE divergence0.004