Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G37030-AT3G53250
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SAUR-like auxin-responsive protein family
Function (paralog2):SAUR-like auxin-responsive protein family

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.31503786770392
Log2 mRNA fold difference:0.66531127243259
Log2 TE fold difference:-1.1970552925646
Sequences
Protein sequence

MKSKFIKSCEKKLKKMTSKVIIPCASCESCYERICWAFKKEAEVIPRDVPKGHLVVYVGE
EYKRFVININLLKHPLFQALLDQAQDAYGFSADSRLWIPCNESTFLDVVRCAGAPQHQNN
CICI

MKSKSIVLPCCTSSCESCCDKVSWGFKKENEAIPKDVPRGHLVVYVGDDYKRFVIKMSLL
THPIFKALLDQAQDAYNSSRLWIPCDENTFLDVVRCSGAPQHQRNCIGM

Other information
Ka divergence:-0.117247KaKs divergence:-0.999814
GC content 1 (%):44GC content 2 (%):40GC content divergence:-0.048
Length 1 (bp):375Length 2 (bp):330Length divergence:-0.064
MFE 1 (kcal):-108.2MFE 2 (kcal):-96.1MFE divergence-0.059