Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G37060-AT3G53340
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):nuclear factor Y, subunit B8
Function (paralog2):nuclear factor Y, subunit B10

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.63916456463629
Log2 mRNA fold difference:0.012555536793016
Log2 TE fold difference:0.45010096816783
Sequences
Protein sequence

MAESQAKSPGGCGSHESGGDQSPRSLHVREQDRFLPIANISRIMKRGLPANGKIAKDAKE
IVQECVSEFISFVTSEASDKCQREKRKTINGDDLLWAMATLGFEDYMEPLKVYLMRYREM
EGDTKGSAKGGDPNAKKDGQSSQNGQFSQLAHQGPYGNSQAQQHMMVPMPGTD

MAESQTGGGGGGSHESGGDQSPRSLNVREQDRFLPIANISRIMKRGLPLNGKIAKDAKET
MQECVSEFISFVTSEASDKCQREKRKTINGDDLLWAMATLGFEDYIDPLKVYLMRYREME
GDTKGSGKGGESSAKRDGQPSQVSQFSQVPQQGSFSQGPYGNSQGSNMMVQMPGTE

Other information
Ka divergence:0.215955KaKs divergence:-0.244281
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):522Length 2 (bp):531Length divergence:0.009
MFE 1 (kcal):-156.2MFE 2 (kcal):-170.26MFE divergence0.043