Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G37070-AT3G53320
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.9632310641736
Log2 mRNA fold difference:2.025016573797
Log2 TE fold difference:-0.28716760016731
Sequences
Protein sequence

MGEEKENWRSELDDINGLSLIDFSAEDDNLLLSSFLDPTTFDFSDTDKEDRGLCLFGDTH
NCCDEETLGSTTLEEKEPHKIMKTNLRKSLAWDKAFFTNAGVLEPDELSSMMGRKSLPAV
QEDLHRSTESMSTLKSDCTVETGQEFFMCDAATPDKRKDLGSTEAVPSPTTSTLDDPSSE
EKMKPNPIRKRPGIRSQGLAKATKHPVASEEHNTSISRPSTGLNRPSSGLSKTKRASVDT
NKAKQETNPKSSGGKEPLASRVPISRRPRPIVSTPVVPFKSALRSSVASKNELTSSCSSI
ESCLSVSSTASNKPSIHSVKQKKDQSLRIASHSLANRPKSSAGSRNIDQLKVPPVSAGRT
YKFNVSRLSSSVDWSSESPRAFTPNKMAKGNKKSVHGDNGPPTDYTTQTLKPLNNSKDVS
VVQDDPKPSASMMKPTGLRVPSPKVGYFDGARGSVARTPTGSCTGPVSGLSKHGACSPDE
FTPSRTAKSQPTMSKAAVRPVSRSSRLIVSASPKLTNKRYSKVSAEEQLG

MEDKESKKSEVEVDGLGLIDVAVEDDSLLFSEFSETDKDDKCLKEDKDLNFMRDTQYCDD
EILASSVEEKEEVLQPHESPEPEKVMKKGKYNLRKSLAWDNEFFTSAGVLEPEELSSMME
SNHKSGKKALPTILEDINRSTESISTFQSDCTVENSQEFVLFEDVRASIQRSAKTSDVAT
PGKSNVLRATDVAISPTSSTVDVTATQGKTKSKGSPRNPSRVQGPGKATKQPVATRGLST
SISKPPNGLSKVRPLSTTSTNRSSLDISKTQQEKNSKLPAGKEPLGPRISMSRRAKPVLP
KPGVPFKSSSRSSDASKNEMTSSCSSLESCASASSSASHKPSIDSIKKKNDSSSRLSSQP
LANRSTSRGIMGQPRIPPQQTNKTSKPKLSSSVPTAGSISDYSSESSRASETSKMANGNQ
KTVSREKVPANDNTVQTVKPLKNSKDTSVVQADAKEGTKRVSAINGGLVPSASAKPSGLR
VPSPKIGFFDGARHGSSSSASKKSGGKTQPARSPIQESTNSKSKASSKVVSVSSPKLPNK
LYSKIDAEDQLEG

www.000webhost.com

Other information
Ka divergence:0.0999597KaKs divergence:0.0309751
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):1593Length 2 (bp):1662Length divergence:0.021
MFE 1 (kcal):-452MFE 2 (kcal):-444.24MFE divergence-0.009