Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G37080-AT3G53350
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ROP interactive partner 3
Function (paralog2):ROP interactive partner 4

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.8077282462342
Log2 mRNA fold difference:-2.0368729014656
Log2 TE fold difference:0.2339102702329
Sequences
Protein sequence

MQTPKPRPGSLEVPQKKSPASTPKTARKLKTSESDPVSSPNTKIRTPKTQSPKVVADRRS
PRTPVNEIQKKRTGKTPELASQISQLQEELKKAKEQLSASEALKKEAQDQAEETKQQLME
INASEDSRIDELRKLSQERDKAWQSELEAMQRQHAMDSAALSSTMNEVQKLKAQLSESEN
VENLRMELNETLSLVEKLRGELFDAKEGEAQAHEIVSGTEKQLEIANLTLEMLRSDGMKM
SEACNSLTTELEQSKSEVRSLEQLVRQLEEEDEARGNANGDSSSVEELKEEINVARQEIS
QLKSAVEVTERRYHEEYIQSTLQIRTAYEQVDEVKSGYAQREAELGEELKKTKAERDSLH
ERLMDKEAKLRILVDENEILNSKIKEKEEVYLNLENSLNQNEPEDTGELKKLESDVMELR
ANLMDKEMELQSVMSQYESLRSEMETMQSEKNKAIDEALAKLGSLTEEADKSGKRAENAT
EQLGAAQVTNTELEAELRRLKVQCDQWRKAAEAAATMLSGGNNNNNSNGKYVERTGSLES
PLRRRNVNMSPYMGETDDELSSPKKKNGSMLKKIGVLLKKSQK

MQTPKSRPGSLELPQKKSPLPAPKVVRRLKPSGAESDPKTKTISKTQIPKVVADRRSARI
PLNEIQKKRTGRIPELESTISQLQEELKKAKEELNRSEALKREAQEEAEDAKHQLMDINA
SEDSRIEELRKLSQERDKTWQSELEAMQRQHGMDSTALSSAINEVQKLKSKLFESESELE
QSKYEVRSLEKLVRQLEEERVNSRDSSSSMEVEELKEAMNLSRQEITQLKSAVEAAETRY
QEEYIQSTLQIRSAYEQTEAVKSRYSQREAELTEELNRTKDEIEGLRKELMEKVKEDEST
GDLKKLESDLMEVRGSLMDKEMELQILRSAMEKKVETANTEAMEAELKRVKIQCEQWRKA
AETAASILNNDEERTDSIETSKMLKKFGVLLKKNHK

www.000webhost.com

Other information
Ka divergence:0.400325KaKs divergence:0.292557
GC content 1 (%):45GC content 2 (%):42GC content divergence:-0.034
Length 1 (bp):1752Length 2 (bp):1191Length divergence:-0.191
MFE 1 (kcal):-498.16MFE 2 (kcal):-313.43MFE divergence-0.228