Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G37160-AT3G53390
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Transducin/WD40 repeat-like superfamily protein
Function (paralog2):Transducin/WD40 repeat-like superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.58440347804795
Log2 mRNA fold difference:0.47071975754619
Log2 TE fold difference:0.050928960701192
Sequences
Protein sequence

MMNTSNGMISGPSSSSASAANPQSPGIKTYFKTPEGKYKLHYEKTHPSGLLHYTHGKTVT
QVLCKNIKCTFHFYVLKVVSENGFVKFWCQVTLAHLKDKPAPSTPTGTSSSSTASSGFRS
ATARLLGGGNGNRALSFVGGNGGAKNVGASSRIGASFAASSSNTSATNTNFDGKGTYLVF
NVGDAIFISDLNSQDKDPVKSIHISNSNPMCHAFHPDAKDGHDLLIGLNSGDVYTVSLRQ
QLQDVGKKLVSAQHYNKDGSVNNSRCTSIAWVPGGDGSFVAAHADGNLYVYEKNKEGATD
SSFSAIRDPTQFSVDKAKYSKSNPVARWHIGQGAINSIAFSNDGAYLATVGRDGYLRIFD
FSTQKLVCGVKSYYGALLCCAWSMDGKYLLTGGEDDLVQVWSMEDRKVVAWGEGHNSWVS
GVAFDSYWSSPNSEGSGENVMYRFGSVGQDTQLLLWDLEMDEIVVPLRRPPGGSPTYSTG
SQSAHWDNIVPMGTLQPAPCMRDVPKLSPVVAHRVHTEPLSGLIFTQESLITACREGHLK
IWTRPDTQPSSSSEATNPTTSKPSLTSKVGGSS

MMNTSNGMISAPSSSSSPAANPQSPGIKTYFKTPEGKYKLHYEKTHSSGLLHYAHGKTVT
QVTIAQLKERAAPSTPTGTSSGYSASSGFRSATARLLGTGNGSRALSFVGGNGGGKSVST
SSRISGSFAASNSNTSMTNTNFDGKGTYLVFNVSDAIFICDLNSQEKDPVKSIHFSNSNP
MCHAFDPDAKDGHDLLIGLNSGDVYTVSLRQQLQDVSKKLVGALHYNKDGSVNNSRCTSI
SWVPGGDGAFVVAHADGNLYVYEKNKDGATESTFPAIRDPTQFSVDKAKYSKSNPVARWH
ICQGSINSIAFSNDGAHLATVGRDGYLRIFDFLTQKLVCGGKSYYGALLCCSWSMDGKYI
LTGGEDDLVQVWSMEDRKVVAWGEGHNSWVSGVAFDSNWSSPNSDGSGEHVMYRFGSVGQ
DTQLLLWDLEMDEIVVPLRRAPGGSPTYSTGSSAHWDNVIPMGTLQPAPCKRDVPKLSPI
IAHRVHTEPLSGLMFTQESVVTACREGHIKIWTRPSESETQTNSSEANPTTALLSTSFTK
DNKASLSSKIISGSTFKQ

www.000webhost.com

Other information
Ka divergence:0.0911681KaKs divergence:0.0882353
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1722Length 2 (bp):1677Length divergence:-0.013
MFE 1 (kcal):-529.61MFE 2 (kcal):-505.4MFE divergence-0.023