Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G37170-AT2G37180
Species:Arabidopsis
Duplication type:TD
Function (paralog1):plasma membrane intrinsic protein 2
Function (paralog2):Aquaporin-like superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.4640841236987
Log2 mRNA fold difference:-1.6977038688087
Log2 TE fold difference:0.39965840171185
Sequences
Protein sequence

MAKDVEGPEGFQTRDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYITVLTVIGY
KIQSDTKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL
IRAVLYMVAQCLGAICGVGFVKAFQSSYYDRYGGGANSLADGYNTGTGLAAEIIGTFVLV
YTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKS
KPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAANV

MAKDVEGPDGFQTRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIGY
KIQSDTKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL
IRAVLYMVAQCLGAICGVGFVKAFQSSHYVNYGGGANFLADGYNTGTGLAAEIIGTFVLV
YTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFNKS
KPWDDHWIFWVGPFIGATIAAFYHQFVLRASGSKSLGSFRSAANV

Other information
Ka divergence:0.51682KaKs divergence:-0.999846
GC content 1 (%):51GC content 2 (%):50GC content divergence:-0.01
Length 1 (bp):858Length 2 (bp):858Length divergence:0
MFE 1 (kcal):-303.22MFE 2 (kcal):-297.93MFE divergence-0.009