Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G37170-AT3G53420
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):plasma membrane intrinsic protein 2
Function (paralog2):plasma membrane intrinsic protein 2A

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.58026925372943
Log2 mRNA fold difference:0.21046260986195
Log2 TE fold difference:0.38683120067442
Sequences
Protein sequence

MAKDVEGPEGFQTRDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYITVLTVIGY
KIQSDTKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL
IRAVLYMVAQCLGAICGVGFVKAFQSSYYDRYGGGANSLADGYNTGTGLAAEIIGTFVLV
YTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKS
KPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAANV

MAKDVEAVPGEGFQTRDYQDPPPAPFIDGAELKKWSFYRAVIAEFVATLLFLYITVLTVI
GYKIQSDTDAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
SLPRALLYIIAQCLGAICGVGFVKAFQSSYYTRYGGGANSLADGYSTGTGLAAEIIGTFV
LVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN
KSKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAANV

www.000webhost.com

Other information
Ka divergence:0.0284801KaKs divergence:-0.133047
GC content 1 (%):51GC content 2 (%):50GC content divergence:-0.01
Length 1 (bp):858Length 2 (bp):864Length divergence:0.003
MFE 1 (kcal):-303.22MFE 2 (kcal):-299.43MFE divergence-0.006