Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G37190-AT3G53430
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ribosomal protein L11 family protein
Function (paralog2):Ribosomal protein L11 family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.43068111961436
Log2 mRNA fold difference:1.6652636783817
Log2 TE fold difference:-0.78882309965397
Sequences
Protein sequence

MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVT
VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVTEIARIMRPR
SIAKELSGTVREILGTCVSVGCTVDGKDPKDIQQEIQDGEVEIPEN

MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVT
VKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIKHNGNISFDDVTEIARIMRPR
SIAKELSGTVREILGTCVSVGCTVDGKDPKDLQQEIQEGEIEIPEN

Other information
Ka divergence:-0.363173KaKs divergence:-0.187166
GC content 1 (%):47GC content 2 (%):50GC content divergence:0.031
Length 1 (bp):501Length 2 (bp):501Length divergence:0
MFE 1 (kcal):-138.7MFE 2 (kcal):-161.6MFE divergence0.076