Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G37220-AT3G53460
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RNA-binding (RRM/RBD/RNP motifs) family protein
Function (paralog2):chloroplast RNA-binding protein 29

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.1217418291238
Log2 mRNA fold difference:0.32902302117426
Log2 TE fold difference:-1.4852995635165
Sequences
Protein sequence

MAASASSLALSSFNPKSLPFGVSRPASVSLLSPSLSFKLNSDSVSFSIAAKWNSPASRFA
RNVAITSEFEVEEDGFADVAPPKEQSFSADLKLFVGNLPFNVDSAQLAQLFESAGNVEMV
EVIYDKITGRSRGFGFVTMSSVSEVEAAAQQFNGYELDGRPLRVNAGPPPPKREDGFSRG
PRSSFGSSGSGYGGGGGSGAGSGNRVYVGNLSWGVDDMALESLFSEQGKVVEARVIYDRD
SGRSKGFGFVTYDSSQEVQNAIKSLDGADLDGRQIRVSEAEARPPRRQY

MSASASSLSAFNPKSLPLCVSRPASVSVLPPSLSFKLHSDHLVSIFASSALKCSSPAEYP
SRFVRNVAVSSDFEVEEDDMFADGDDSAPVERNSFSPDLKLFVGNLSFNVDSAQLAQLFE
SAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVEAAAQQFNGYVSRYLCSLLCLYLLIRV
LCGLEFEGRPLRVNAGPPPPKREESFSRGPRSGGYGSERGGGYGSERGGGYGSERGGGYG
SERGGGYGSQRSGGGYGGSQRSSYGSGSGSGSGSGSGNRLYVGNLSWGVDDMALENLFNE
QGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEARPPR
GQF

Other information
Ka divergence:-0.0634776KaKs divergence:-0.0702157
GC content 1 (%):49GC content 2 (%):50GC content divergence:0.01
Length 1 (bp):870Length 2 (bp):1092Length divergence:0.113
MFE 1 (kcal):-296.76MFE 2 (kcal):-379.35MFE divergence0.122