Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G37280-AT3G53480
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):pleiotropic drug resistance 5
Function (paralog2):pleiotropic drug resistance 9

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:3.3588776514789
Log2 mRNA fold difference:4.3166100727805
Log2 TE fold difference:-0.8741701721958
Sequences
Protein sequence

MGSSFRSSSSRNEHEDGGDEAEHALQWAEIQRLPTFKRLRSSLVDKYGEGTEKGKKVVDV
TKLGAMERHLMIEKLIKHIENDNLKLLKKIRRRMERVGVEFPSIEVRYEHLGVEAACEVV
EGKALPTLWNSLKHVFLDLLKLSGVRTNEANIKILTDVSGIISPGRLTLLLGPPGCGKTT
LLKALSGNLENNLKCYGEISYNGHGLNEVVPQKTSAYISQHDLHIAEMTTRETIDFSARC
QGVGSRTDIMMEVSKREKDGGIIPDPEIDAYMKAISVKGLKRSLQTDYILKILGLDICAE
TLVGNAMKRGISGGQKKRLTTAEMIVGPTKALFMDEITNGLDSSTAFQIIKSLQQVAHIT
NATVFVSLLQPAPESYDLFDDIVLMAEGKIVYHGPRDDVLKFFEECGFQCPERKGVADFL
QEVISKKDQGQYWLHQNLPHSFVSVDTLSKRFKDLEIGRKIEEALSKPYDISKTHKDALS
FNVYSLPKWELFRACISREFLLMKRNYFVYLFKTFQLVLAAIITMTVFIRTRMDIDIIHG
NSYMSCLFFATVVLLVDGIPELSMTVQRLSVFYKQKQLCFYPAWAYAIPATVLKIPLSFF
ESLVWTCLTYYVIGYTPEPYRFFRQFMILFAVHFTSISMFRCIAAIFQTGVAAMTAGSFV
MLITFVFAGFAIPYTDMPGWLKWGFWVNPISYAEIGLSVNEFLAPRWQKMQPTNVTLGRT
ILESRGLNYDDYMYWVSLSALLGLTIIFNTIFTLALSFLKSPTSSRPMISQDKLSELQGT
KDSSVKKNKPLDSSIKTNEDPGKMILPFKPLTITFQDLNYYVDVPVEMKGQGYNEKKLQL
LSEITGAFRPGVLTALMGISGAGKTTLLDVLAGRKTSGYIEGEIRISGFLKVQETFARVS
GYCEQTDIHSPSITVEESLIYSAWLRLVPEINPQTKIRFVKQVLETIELEEIKDALVGVA
GVSGLSTEQRKRLTVAVELVANPSIIFMDEPTTGLDARAAAIVMRAVKNVAETGRTIVCT
IHQPSIHIFEAFDELVLLKRGGRMIYSGPLGQHSSCVIEYFQNIPGVAKIRDKYNPATWM
LEVTSESVETELDMDFAKIYNESDLYKNNSELVKELSKPDHGSSDLHFKRTFAQNWWEQF
KSCLWKMSLSYWRSPSYNLMRIGHTFISSFIFGLLFWNQGKKIDTQQNLFTVLGAIYGLV
LFVGINNCTSALQYFETERNVMYRERFAGMYSAFAYALAQVVTEIPYIFIQSAEFVIVIY
PMIGFYASFSKVFWSLYAMFCNLLCFNYLAMFLISITPNFMVAAILQSLFFTTFNIFAGF
LIPKPQIPKWWVWFYYITPTSWTLNLFFSSQYGDIHQKINAFGETKTVASFLEDYFGFHH
DRLMITAIILIAFPIALATMYAFFVAKLNFQKR

MAHMVGADDIESLRVELAEIGRSIRSSFRRHTSSFRSSSSIYEVENDGDVNDHDAEYALQ
WAEIERLPTVKRMRSTLLDDGDESMTEKGRRVVDVTKLGAVERHLMIEKLIKHIENDNLK
LLKKIRRRIDRVGMELPTIEVRYESLKVVAECEVVEGKALPTLWNTAKRVLSELVKLTGA
KTHEAKINIINDVNGIIKPGRLTLLLGPPSCGKTTLLKALSGNLENNLKCSGEISYNGHR
LDEFVPQKTSAYISQYDLHIAEMTVRETVDFSARCQGVGSRTDIMMEVSKREKEKGIIPD
TEVDAYMKAISVEGLQRSLQTDYILKILGLDICAEILIGDVMRRGISGGQKKRLTTAEMI
VGPTKALFMDEITNGLDSSTAFQIVKSLQQFAHISSATVLVSLLQPAPESYDLFDDIMLM
AKGRIVYHGPRGEVLNFFEDCGFRCPERKGVADFLQEVISKKDQAQYWWHEDLPYSFVSV
EMLSKKFKDLSIGKKIEDTLSKPYDRSKSHKDALSFSVYSLPNWELFIACISREYLLMKR
NYFVYIFKTAQLVMAAFITMTVFIRTRMGIDIIHGNSYMSALFFALIILLVDGFPELSMT
AQRLAVFYKQKQLCFYPAWAYAIPATVLKVPLSFFESLVWTCLSYYVIGYTPEASRFFKQ
FILLFAVHFTSISMFRCLAAIFQTVVASITAGSFGILFTFVFAGFVIPPPSMPAWLKWGF
WANPLSYGEIGLSVNEFLAPRWNQMQPNNFTLGRTILQTRGMDYNGYMYWVSLCALLGFT
VLFNIIFTLALTFLKSPTSSRAMISQDKLSELQGTEKSTEDSSVRKKTTDSPVKTEEEDK
MVLPFKPLTVTFQDLNYFVDMPVEMRDQGYDQKKLQLLSDITGAFRPGILTALMGVSGAG
KTTLLDVLAGRKTSGYIEGDIRISGFPKVQETFARVSGYCEQTDIHSPNITVEESVIYSA
WLRLAPEIDATTKTKFVKQVLETIELDEIKDSLVGVTGVSGLSTEQRKRLTIAVELVANP
SIIFMDEPTTGLDARAAAIVMRAVKNVADTGRTIVCTIHQPSIDIFEAFDELVLLKRGGR
MIYTGPLGQHSRHIIEYFESVPEIPKIKDNHNPATWMLDVSSQSVEIELGVDFAKIYHDS
ALYKRNSELVKQLSQPDSGSSDIQFKRTFAQSWWGQFKSILWKMNLSYWRSPSYNLMRMM
HTLVSSLIFGALFWKQGQNLDTQQSMFTVFGAIYGLVLFLGINNCASALQYFETERNVMY
RERFAGMYSATAYALGQVVTEIPYIFIQAAEFVIVTYPMIGFYPSAYKVFWSLYSMFCSL
LTFNYLAMFLVSITPNFMVAAILQSLFYVGFNLFSGFLIPQTQVPGWWIWLYYLTPTSWT
LNGFISSQYGDIHEEINVFGQSTTVARFLKDYFGFHHDLLAVTAVVQIAFPIALASMFAF
FVGKLNFQRR

Other information
Ka divergence:-0.0379972KaKs divergence:0.304859
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):4242Length 2 (bp):4353Length divergence:0.013
MFE 1 (kcal):-1278.19MFE 2 (kcal):-1288.73MFE divergence0.004