Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G37340-AT3G53500
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):arginine/serine-rich zinc knuckle-containing protein 33
Function (paralog2):RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.32271658775483
Log2 mRNA fold difference:0.28786174699085
Log2 TE fold difference:0.014925996343781
Sequences
Protein sequence

MPRYDDRYGNTRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRDYAFVEFGDPRDADDA
RHYLDGRDFDGSRITVEFSRGAPRGSRDFDSRGPPPGAGRCFNCGVDGHWARDCTAGDWK
NKCYRCGERGHIERNCKNSPKKLRRSGSYSRSPVRSRSPRRRRSPSRSLSRSRSYSRSRS
PVRRRERSVEERSRSPKRMDDSLSPRARDRSPVLDDEGSPKIIDGSPPPSPKLQKEVGSD
RDGGSPQDNGRNSVVSPVVGAGGDSSKEDRSPVDDDYEPNRTSPRGSESP

MPRYDDRYGNTRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRDYAFVEFSDPRDADDA
RYYLDGRDFDGSRITVEASRGAPRGSRDNGSRGPPPGSGRCFNCGVDGHWARDCTAGDWK
NKCYRCGERGHIERNCKNSPSPKKARQGGSYSRSPVKSRSPRRRRSPSRSRSYSRGRSYS
RSRSPVRREKSVEDRSRSPKAMERSVSPKGRDQSLSPDRKVIDASPKRGSDYDGSPKENG
NGRNSASPIVGGGESPVGLNGQDRSPIDDEAELSRPSPKGSESP

www.000webhost.com

Other information
Ka divergence:-0.140172KaKs divergence:0.318681
GC content 1 (%):52GC content 2 (%):51GC content divergence:-0.01
Length 1 (bp):873Length 2 (bp):855Length divergence:-0.01
MFE 1 (kcal):-291.9MFE 2 (kcal):-290.01MFE divergence-0.003