Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G37360-AT3G53510
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ABC-2 type transporter family protein
Function (paralog2):ABC-2 type transporter family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.88150007019911
Log2 mRNA fold difference:1.923528086613
Log2 TE fold difference:-0.21995420136154
Sequences
Protein sequence

MSGLLGKSSPAKRVDGNNDLPMYYVNPMSVEPQGRPSDTTRVSVTFAEHLMNVEDARNDE
SASSRALGIASPINSAASSFNSWASAPASSISSSPFVLSFTDLTYSVKIQKKFNPLACCR
RSGNDSSVNTKILLNGISGEAREGEMMAVLGASGSGKSTLIDALANRIAKDSLRGSITLN
GEVLESSMQKVISAYVMQDDLLFPMLTVEETLMFSAEFRLPRSLSKKKKKARVQALIDQL
GLRSAAKTVIGDEGHRGVSGGERRRVSIGNDIIHDPIILFLDEPTSGLDSTSAYMVIKVL
QRIAQSGSIVIMSIHQPSYRIMGLLDQLIFLSKGNTVYSGSPTHLPQFFSEFKHPIPENE
NKTEFALDLIRELEYSTEGTKPLVEFHKQWRAKQAPSYNNNNKRNTNVSSLKEAITASIS
RGKLVSGATNNNSSNLTPSFQTFANPFWIEMIVIGKRAILNSRRQPELLGMRLGAVMVTG
IILATMFTNLDNSPKGAQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRR
SSYVLSQSIISIPALIVLSASFAATTFWAVGLDGGANGFFFFYFTILASFWAGSSFVTFL
SGVIPNVMLGFTVVVAILAYFLLFSGFFISRDRIPVYWLWFHYISLVKYPYEGVLQNEFQ
NPTRCFARGVQLFDNSPLGEFPNDVKVNLLKSMSGVLGTNVTAETCVTTGIDILKQQGIT
DISKWNCLWITVAWGFFFRVLFYFTLLIGSKNKRK

MSGLFGILSPAKRVNGDGLPLFYNIHKSVELQRCHRDTARVSVTLAELLMSVEDEGDDQS
RAMDIAVASNFWSSVPSSRVPSSSPFVLSFKDLTYSVKIKKKFKPFPCCGNSPFDGNDME
MNTKVLLNGISGEAREGEMMAVLGASGSGKSTLIDALANRISKESLRGDITLNGEVLESS
LHKVISAYVMQDDLLFPMLTVEETLMFSAEFRLPSSLSKKKKKARVQALIDQLGLRNAAK
TVIGDEGHRGVSGGERRRVSIGTDIIHDPIILFLDEPTSGLDSTSAYMVVKVLQRIAQSG
SIVIMSIHQPSYRILGLLDKLIFLSRGNTVYSGSPTHLPQFFSEFGHPIPENENKPEFAL
DLIRELEDSPEGTKSLVEFHKQWRAKQTSSQSRRNTNVSLKDAISASISRGKLVSGATNL
RSSFQTFANPFWTEMLVIGKRSILNSRRQPELFGIRLGAVLVTGMILATIFWKLDNSPRG
IQERLGFFAFAMSTTFYTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLAHTIISIPALI
ILSAAFAASTFSAVGLAGGSEGFLFFFFTILTAFWAGSSFVTFLSGVVSHVMIGFTVVVA
ILAYFLLFSGFFISRDRIPLYWIWFHYLSLVKYPYEGVLQNEFEDPTKCFVRGIQMFDNS
PLGQVPTAVKISLLKSMSGVLGINVTAETCVTTGIDILKQQGITEISKWNCLWITVAWGF
FFRVLFYFTLLIGSKNKRR

www.000webhost.com

Other information
Ka divergence:-0.296028KaKs divergence:-0.367058
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):2268Length 2 (bp):2220Length divergence:-0.011
MFE 1 (kcal):-679.64MFE 2 (kcal):-700.49MFE divergence0.015