Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G37390-AT3G53530
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Chloroplast-targeted copper chaperone protein
Function (paralog2):Chloroplast-targeted copper chaperone protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.2151635771097
Log2 mRNA fold difference:-1.1517660179483
Log2 TE fold difference:1.317310020033
Sequences
Protein sequence

MKGRMFCASQASTAICSSMDHVHKSTTTDEDERNSGRAIDRHNPIIKDGRRSFADDFIKL
PTSAEDGEMSNKKLEIYKGRRSITGRRSTGGGGGGGAAALLKLITNDIGLARKSFSCVAR
PACDLIKTPVGSTRYLLGSDPDSITGSVDQDPAKTVEAEAPAGEDKTLTEKKTTCGDTDQ
QVVVLKVSLHCRGCEGKVRKHLARMQGVTSFNIDFAAKKVTVTGDITPLEILDSISKVKN
AQFWTNPTIPKPNVETQNP

MKAGMFYCASQASTATANGERTVTARAIDRHNPIIKDGRRSFTAPCSSGDDYVAPYRQLS
KITRVPSSSGDGKSVQVDKGRRSNSGSLMKLISYDVSLARKSFGCVVATPKTPPGSTRYL
LGSDPVSLAGSTGQDTVATEESEASAPKRGSSGPVEEKKKSSGSGSDQVVVLRVSLHCHC
RGCQGKVKKHLSKMQVGVTSFNIDFASKKVTVTGDITPLEVLGCLSKVKNAQFWTPPPPS
IPRANPET

Other information
Ka divergence:-0.0761406KaKs divergence:-0.00300391
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):780Length 2 (bp):747Length divergence:-0.022
MFE 1 (kcal):-230.22MFE 2 (kcal):-240.73MFE divergence0.022