Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G37400-AT3G53560
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Tetratricopeptide repeat (TPR)-like superfamily protein
Function (paralog2):Tetratricopeptide repeat (TPR)-like superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.8722954313142
Log2 mRNA fold difference:2.1696649305036
Log2 TE fold difference:-0.15906427549445
Sequences
Protein sequence

MESLGKLQLHQQPNHLSFTHFSSSFPKKPSSFSLRSLPRSTSSFKCISIKASSSKSQDSK
LSILKSTCVSFTAAAALFLVNLQLKPSPAIAAPVAATPLMESLKQSNGNVSFEEEERSLE
EYLASHPDDVEALRSLMEVRIKSRKLLEAIELIDRLIELEPEEKEWPMLKANIFSYSGDL
ESAKTGFEEILVKDPLRVEAYHGLVMAYSDSGDDLNAVEKRIEEAMVRCKKEKNRKDLRD
FKLLVAQIRVIEGKHNEALKLYEELVKEEPRDFRPYLCQGIIYTVLKKENEAEKQFEKFR
RLVPKNHPYREYFMDNMVASKLFAEKVQREMAE

MESLGKLQLHHQPFHLSFTHTSSSTFPKNLFKSSIQPISSLKSASIKASSSKFQNSITPL
PKSTPFRLFKSTCITLTTAAALLLANLHLKSPAIAAPIAPPPSVESKENVTLEEEERALD
EHLITHPSDVDALRSLMEVKIKSRKLTEAVEVIDRLIKLEPEEKEWPVLKANIFTYSGDL
DLAKTGFEEILAKDPLRVEAYHGLLMAYSDAGLDLKEVESRIEEAMLKCKKENNQNDFRD
FKLLVAQIRVIEGKHSEALKLYQELVKEEPRDFRPYLCQGIIYTLLKKKDKAEEQFDNFR
KLVPKNHPYREYFMDNMIATKLFSEKAQREMAEEMAGSTS

Other information
Ka divergence:-0.0351873KaKs divergence:0.183927
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):1002Length 2 (bp):1023Length divergence:0.01
MFE 1 (kcal):-300.99MFE 2 (kcal):-282.5MFE divergence-0.032