Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G37430-AT3G53600
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):C2H2 and C2HC zinc fingers superfamily protein
Function (paralog2):C2H2-type zinc finger family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.1584716655449
Log2 mRNA fold difference:-1.2809262058368
Log2 TE fold difference:0.43931712261988
Sequences
Protein sequence

MKRERSDFEESLKNIDIAKCLMILAQTSMVKQIGLNQHTESHTSNQFECKTCNKRFSSFQ
ALGGHRASHKKPKLTVEQKDVKHLSNDYKGNHFHKCSICSQSFGTGQALGGHMRRHRSSM
TVEPSFISPMIPSMPVLKRCGSSKRILSLDLNLTPLENDLEYIFGKTFVPKIDMKFVL

MKRDRSDYEESMKHIDIVESLMMLSRSFVVKQIDVKQSTGSKTNHNNHFECKTCNRKFDS
FQALGGHRASHKKPKLIVDQEQVKHRNKENDMHKCTICDQMFGTGQALGGHMRKHRTSMI
TEQSIVPSVVYSRPVFNRCSSSKEILDLNLTPLENDLVLIFGKNLVPQIDLKFVN

Other information
Ka divergence:0.189081KaKs divergence:0.996459
GC content 1 (%):41GC content 2 (%):40GC content divergence:-0.012
Length 1 (bp):537Length 2 (bp):528Length divergence:-0.008
MFE 1 (kcal):-150.03MFE 2 (kcal):-136.3MFE divergence-0.048