Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G37450-AT2G37460
Species:Arabidopsis
Duplication type:TD
Function (paralog1):nodulin MtN21 /EamA-like transporter family protein
Function (paralog2):nodulin MtN21 /EamA-like transporter family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.9935480882427
Log2 mRNA fold difference:-0.34400395486636
Log2 TE fold difference:2.2146041914359
Sequences
Protein sequence

MACMKKALPFILMVLLQIGYAGMDILTKDVLNKGMSIYVLSVYRHGVATVVMAPFAFYFD
NPVIAQNLFNLGMKYTTATFAIALYNTLPAVTFILALIFRLESVKFQSIRSAAKVVGTVT
TVGGIMVMTLVKGPALDLFWTKGPSAQNTVGTDIHSSIKGAVLVTIGCFSYACFMILQAI
TLKTYPAELSLATWICLIGTIEGVVVALVMEKGNPSVWAIGWDTKLLTITYSGIVCSALG
YYIGGVVMKTRGPVFVTAFKPLCMIVVAIMSSIIFDEQMYLGRALGATVICVGLYLVIWG
KAKDYEYPSTPQIDDDLAQATTSKQKEQRRTVIESV

MEEVKKRDCMEKARPFISMVVLQVGLAGMDILSKAVLNKGMSNYVLVVYRHAVATIVMAP
FAFYFDKKVRPKMTLMIFFKISLLGLLEPVIDQNLYYLGMKYTTATFATAMYNVLPAITF
VLAYIFGLERVKLRCIRSTGKVVGTLATVGGAMIMTLVKGPVLDLFWTKGVSAHNTAGTD
IHSAIKGAVLVTIGCFSYACFMILQAITLRTYPAELSLTAWICLMGTIEGTAVALVMEKG
NPSAWAIGWDTKLLTATYSGIVCSALAYYVGGVVMKTRGPVFVTAFSPLCMIIVAIMSTI
IFAEQMYLGRVLGAVVICAGLYLVIWGKGKDYKYNSTLQLDDESAQPKLELSGNGKDNVD
HEVITISKQGEQRRTAVETV

Other information
Ka divergence:-0.564372KaKs divergence:-0.81554
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):1011Length 2 (bp):1143Length divergence:0.061
MFE 1 (kcal):-290.42MFE 2 (kcal):-342.9MFE divergence0.083