Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G37470-AT3G53650
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Histone superfamily protein
Function (paralog2):Histone superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.4566049004695
Log2 mRNA fold difference:-1.7681173451584
Log2 TE fold difference:0.29106889292523
Sequences
Protein sequence

MAPKAAEKKPAEKKPAGKAPAEKLPKAEKKISKDAGGSEKKKKKSKKSVETYKIYIFKVL
KQVHPDVGISGKAMGIMNSFINDIFEKLAQESSKLARYNKKPTITSREIQTAVRLVLPGE
LAKHAVSEGTKAVTKFTS

MAPKAAEKKPAGKKPAEKAPAEKLPKAEKKITKEGGSEKKKKKSKKNIETYKIYIFKVLK
QVHPDIGISGKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSREIQTAVRLVLPGEL
SKHAVSEGTKAVTKFTSS

www.000webhost.com

Other information
Ka divergence:0.0503729KaKs divergence:-0.340342
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):417Length 2 (bp):417Length divergence:0
MFE 1 (kcal):-120.12MFE 2 (kcal):-113.56MFE divergence-0.028