Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G37520-AT3G53680
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Acyl-CoA N-acyltransferase with RING/FYVE/PHD-type zinc finger domain
Function (paralog2):Acyl-CoA N-acyltransferase with RING/FYVE/PHD-type zinc finger domain

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.4694824888515
Log2 mRNA fold difference:-1.8905715460311
Log2 TE fold difference:0.46436962214636
Sequences
Protein sequence

MGEGTICLEMPKEENGQLKRDRLDDDTDEGNKGDHFPSKKQAKEASNDDITSEISNPVAS
PVESTSLFRDVSSQPVKSGLVECSGSDFGSEETVSDDASVVGSSQTEQSSDVLPSRFVLE
IPKHLSSTGITKITFKLSKPKKEFDDLPLIKDHTWDAGVVKMPKKKIVSLSYPSNVKKLL
ETGILEGARVKYISTPPVRQLLGIIHSGGYLCGCTTCNFSKVLSAYEFEQHAGAKTRHPN
NHIFLENRRAVYNIVQELKTAPRVVLEEVIRNVAGSALNEEGLRAWKASFQQSNSMSDRN
YITDHSTVSYLGPGLDESQSLTPCSVENHYFSEKTYAKDTLDEPKRIAKKLTSHVSGTGC
HKKVSEGSNRKRDNDLHRLLFMPNGLPDGTELAYYVKTQKLLQGYKQGSGIVCSCCSREI
SPSQFEAHAGMAARRQPYRHIFISSGLSLHDIAMSLANGHVITTGDSDDMCSICGDGGDL
LLCAGCPQAFHTACLKFQSMPEGTWYCSSCNDGPISSKKATTTDPSGNARPIVIRLSRVV
KAPESDIGGCVFCRSHDFSIGKFDDRTVILCDQCEKEYHVGCLRENGFCDLKEIPQEKWF
CCSNCSRIHTAVQNSVSCGPQTLPTPLLDMICRKDREKGIFTDIGDTVEWRILSGKSRYP
EHLPLLSRAAVIFRECFDPIVAKSGRDLIPVMVYGRNISGQEFGGMYCLVLIVNSLVVSA
ALLRIFGQEVAELPIVATSREYQGRGYFQGLYACVENLLSSLNVENLVLPAAEEAESIWT
KKFGFTKMSDQQLQEYQKEVQLTIFKGTSMLEKKVPKATTGLSESTTLI

MGEATVCFAKENSETKKDLKRDRLCFEQDNLDEEELYSSNKRQTKEPSNDDMKSEISNPV
PSPVVDNASSFRDITSNPAKSSSGDRVGSCSGSYETITDEKHSEYCSSLANSDAVPSSFE
REIPKHLSTTGITKITFKLSKRNEDFCDLPMIQEHTWEGYPSNVASSTLGVKMLKKIDST
NFLSNVKKLLGTGILDGARVKYLSTSAARELQGIIHSGGYLCGCTACDFSKVLGAYEFER
HAGGKTKHPNNHIYLENGRPVYNVIQELRIAPPDVLEEVIRKVAGSALSEEGFQAWKGSF
QQDKNMTEDDSNHIMDHSFQSLVSYPGSGWSLDESQSSTPCFPEDNYFREKICTKDTRHA
HKPKAKKLTSHMFGMGCHKKVSGGGKWKRDNDLHRLLFLPNGLPDGTELAYYVKSQKLLQ
GYKQGSGIVCSCCDTKISPSQFEAHAGMAGRRQPYRRIHISSGLSLHDIAVSLADGGHVI
TTGDSDDMCSICGNGGDLLLCAGCPQAFHTACLKFQSMPEGTWYCSSCNDGPTSCKIATA
SDPNLKPIVIRLTRVVKAPESEIGGCVFCRSHDFSIGKFDDRTVILCDQCEKEYHVGCLR
ENELCDLKGIPQDKWFCCSDCSRIHRVLQSSASCGPQTIPTLLLDTISRKYREKGIYIDN
GNTVEWRMLSGKSRYPEHLPLLSRAATIFRECFDPIVAKSGRDLIPVMVYGRNISGQEFG
GMYCLVLMVNSLVVSAALLRIFGQKVAELPIVATSREYQGRGYFQGLFACVENLLSSLNV
ENLLLPAAEEAESIWTNKFGFTKMTEHRLQRYQREVQLTIFKGTSMLEKKVPSFSESTSI
I

www.000webhost.com

Other information
Ka divergence:0.155729KaKs divergence:0.408834
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):2490Length 2 (bp):2526Length divergence:0.007
MFE 1 (kcal):-775.63MFE 2 (kcal):-778.36MFE divergence0.002