Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G37550-AT3G53710
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ARF-GAP domain 7
Function (paralog2):ARF-GAP domain 6

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.26494197278653
Log2 mRNA fold difference:-0.13035011554931
Log2 TE fold difference:0.36538729758717
Sequences
Protein sequence

MAAARRLRTLQSQPENKVCVDCSQKNPQWASISYGIFMCLECSGKHRGLGVHISFVRSVT
MDSWSEIQIKKMDAGGNERLNNFLAQYGISKETDIISKYNSNAASVYRDRIQALAEGRQW
RDPPIVKESVGGGLMNKKPPLSQGGGRDSGNGGWDNWDNDDSFRSTDMRRNQSAGDFRSS
GGRGAPAKSKSSEDIYSRSQLEASAANKESFFAKRMAENESKPEGLPPSQGGKYVGFGSS
PGPAPRSNQQSGGGDVFSVMSEGFGRLSLVAASAANVVQTGTMEFTSKVKEGGLDQTVSE
TVNVVASKTTEIGQRTWGIMKGVMAIASQKVEEFTKEEASTWNQQNKTEGNGYYQNSGIG
NKTANSSFGGSQSSSSGHNNSYRNSNSWDDWGEENNSKKEAAPKVSTSNDDDDGGWAGWD
DNDAKDDDFYYQPASDKKSVGHNGKSDTAWTGGGFL

MAATRQLRTLQSQPENKVCVDCAQKNPQWASVSYGIFMCLECSGKHRGLGVHISFVRSVT
MDSWSAIQIKKMEAGGNERLNKFFAQYGIAKETDIISKYNSNAASVYRDRIQALAEGRPW
NDPPVVKEANKKPPLAQGGYGNNNNNNNGGWDSWDNDDSYKSDMRRNQSANDFRASGNRE
GAHVKSKSSEDIYTRSQLEASAAGKESFFARRMAENESKPEGLPPSQGGKYVGFGSSSAP
PPRNNQQDDVFSVVSQGFGRLSLVAASAAQSAASVVQTGTKEFTSKVKEGGYDHKVSETV
NVVANKTTEIGHRTWGIMKGVMAMATQKVEEFTKEGSTSWNQQSENEGNGYYQNFGNGNK
AANSSVGGGRPQSSSTSGHYNNSQNSNSWDSWGENENKKTEAVAPKGSSASNDDDGWTGW
DDHDAKDDGFDGHYQSAGDKKSAGHNGKSDTAWTGGGFL

www.000webhost.com

Other information
Ka divergence:0.0439159KaKs divergence:-0.432079
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1371Length 2 (bp):1380Length divergence:0.003
MFE 1 (kcal):-457.04MFE 2 (kcal):-434.81MFE divergence-0.025