Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G37600-AT3G53740
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ribosomal protein L36e family protein
Function (paralog2):Ribosomal protein L36e family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.748835073873
Log2 mRNA fold difference:1.719037900237
Log2 TE fold difference:0.040342401694903
Sequences
Protein sequence

MTTPAVKTGLFVGLNKGHVVTRRELAPRPNSRKGKTSKRTIFIRKLIREVAGMAPYEKRI
TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMRSLGGAAAAEKKM

MTTPQVKTGLFVGLNKGHVVTRRELAPRPRSRKGKTSKRTIFIRNLIKEVAGQAPYEKRI
TELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMRSGGGGATEKKK

Other information
Ka divergence:-0.325631KaKs divergence:-0.999959
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):342Length 2 (bp):339Length divergence:-0.004
MFE 1 (kcal):-100.6MFE 2 (kcal):-96.8MFE divergence-0.019