Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G37620-AT3G53750
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):actin 1
Function (paralog2):actin 3

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.1590651437448
Log2 mRNA fold difference:-0.46399361186996
Log2 TE fold difference:0.31966967963053
Sequences
Protein sequence

MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK
MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
DLAGRDLTDALMKILTERGYSFTTTAEREIVRDIKEKLCYIALDYEQELETAKTSSSVEK
NYELPDGQVITIGSERFRCPEVLYQPSMIGMENAGIHETTYNSIMKCDVDIRKDLYGNIV
LSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIA
KAEYDESGPSIVHRKCF

MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK
MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
DLAGRDLTDALMKILTERGYSFTTTAEREIVRDIKEKLCYIALDYEQELETAKTSSSVEK
NYELPDGQVITIGSERFRCPEVLYQPSMIGMENAGIHETTYNSIMKCDVDIRKDLYGNIV
LSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIA
KAEYDESGPSIVHRKCF

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):1134Length 2 (bp):1134Length divergence:0
MFE 1 (kcal):-364.56MFE 2 (kcal):-372MFE divergence0.01