Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G37710-AT3G53810
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):receptor lectin kinase
Function (paralog2):Concanavalin A-like lectin protein kinase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.5120783127977
Log2 mRNA fold difference:-2.1469424457012
Log2 TE fold difference:0.78882931259574
Sequences
Protein sequence

MFLKLLTIFFFFFFNLIFQSSSQSLNFAYNNGFNPPTDLSIQGITTVTPNGLLKLTNTTV
QKTGHAFYTKPIRFKDSPNGTVSSFSTSFVFAIHSQIAILSGHGIAFVVAPNASLPYGNP
SQYIGLFNLANNGNETNHVFAVELDTILSTEFNDTNDNHVGIDINSLKSVQSSPAGYWDE
KGQFKNLTLISRKPMQVWVDYDGRTNKIDVTMAPFNEDKPTRPLVTAVRDLSSVLLQDMY
VGFSSATGSVLSEHYILGWSFGLNEKAPPLALSRLPKLPRFEPKRISEFYKIGMPLISLF
LIFSFIFLVCYIVRRRRKFAEELEEWEKEFGKNRFRFKDLYYATKGFKEKGLLGTGGFGS
VYKGVMPGTKLEIAVKRVSHESRQGMKEFVAEIVSIGRMSHRNLVPLLGYCRRRGELLLV
YDYMPNGSLDKYLYNTPEVTLNWKQRIKVILGVASGLFYLHEEWEQVVIHRDVKASNVLL
DGELNGRLGDFGLARLYDHGSDPQTTHVVGTLGYLAPEHTRTGRATMATDVFAFGAFLLE
VACGRRPIEFQQETDETFLLVDWVFGLWNKGDILAAKDPNMGSECDEKEVEMVLKLGLLC
SHSDPRARPSMRQVLHYLRGDAKLPELSPLDLSGSGMMFGVHDGFSELGMSYSSSVFKGF
TGGSSIADSQLSGGR

MFVKLKLIFFFFLLCQIMISSSQNLNFTYNGFHPPLTDISLQGLATVTPNGLLKLTNTSV
QKTGHAFCTERIRFKDSQNGNVSSFSTTFVFAIHSQIPTLSGHGIAFVVAPTLGLPFALP
SQYIGLFNISNNGNDTNHIFAVEFDTIQSSEFGDPNDNHVGIDLNGLRSANYSTAGYRDD
HDKFQNLSLISRKRIQVWIDYDNRSHRIDVTVAPFDSDKPRKPLVSYVRDLSSILLEDMY
VGFSSATGSVLSEHFLVGWSFRLNGEAPMLSLSKLPKLPRFEPRRISEFYKIGMPLISLS
LIFSIIFLAFYIVRRKKKYEEELDDWETEFGKNRFRFKELYHATKGFKEKDLLGSGGFGR
VYRGILPTTKLEVAVKRVSHDSKQGMKEFVAEIVSIGRMSHRNLVPLLGYCRRRGELLLV
YDYMPNGSLDKYLYNNPETTLDWKQRSTIIKGVASGLFYLHEEWEQVVIHRDVKASNVLL
DADFNGRLGDFGLARLYDHGSDPQTTHVVGTLGYLAPEHSRTGRATTTTDVYAFGAFLLE
VVSGRRPIEFHSASDDTFLLVEWVFSLWLRGNIMEAKDPKLGSSGYDLEEVEMVLKLGLL
CSHSDPRARPSMRQVLQYLRGDMALPELTPLDLSAGSVMNLGGRDGFSGIAMTDFSTVFK
GFTGGSSIADSLLSGGR

www.000webhost.com

Other information
Ka divergence:-0.0698873KaKs divergence:0.166993
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):2028Length 2 (bp):2034Length divergence:0.001
MFE 1 (kcal):-670.21MFE 2 (kcal):-634.82MFE divergence-0.027