Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G37840-AT3G53930
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.37801326657195
Log2 mRNA fold difference:0.14696677243459
Log2 TE fold difference:0.25321518052392
Sequences
Protein sequence

MAQFTGRVVGDYLVGRQIGSGSFSVVWEARHRVDGTEVAIKEIAMDRLNKKLQESLMSEI
FILRRINHPNIIRLIDMIKSPGKVHLVLEYCKGGDLSVYVQRHGIVPEATAKHFMQQLAA
GLQVLRDNNIIHRDLKPQNLLLSTNENDADLKIADFGFARSLQPRGLAETLCGSPLYMAP
EIMQLQKYDAKADLWSVGAILFQLVTGRTPFTGNSQIQLLQNIIRSTELHFPGDCRDLSL
DCIDLCQKLLRRNPVERLTFEEFFNHPFLSDRQSYDFSRSRLGLRTMDGFLSSGSSPSRN
MEESSQEDCLPFLLDDDSSGPEGSPSYLKKTSSMKSSSGIKVDTRIERKEVESSPLKHTE
LTSGYSSFNQKVENDRFRFETQINSDRRNRREPTGLTDSRSLIAPGRVDDSQDSMDQDFV
LVSGPPVDMPSSSSSSSKPYNFPFKSQSPPVELFNRSISSTAPMPIIGATSNSIGQFGSL
DSQYSAPSTSHGSLDLGDAFEQPSTHSLTRIRSLRKYAATIAELVYERIESDKHLEAFSI
QLAILAIWKQALHICHTQAISGLEGSPSQDINKLRSSSLKHDTHSSNKVTDLSHDGSEEI
SSQIQRQFIQEIELAEELAKSIEPGNTKMPDAMETIFEAALDLGKLGGVKEVMGDTENAG
NQYSKAVRLLVFLLVEAPMLILNPPLSLTNSVRYRLRTYIDFLSRRLKHLQSHRRSSAGQ
MQGSSLAMMNRQS

MAQSSLVAAAGRSGRVIGDYAVGRQIGSGSFSVVWEGRHLVHGTVVAIKEIAMARLNKKL
QESLMSEIIILRKINHPNIIRFIDMIEAPGKINLVLEYCKGGDLSMYIHKHGSVPEATAK
HFMLQLAAGLQVLRDNNIIHRDLKPQNLLLSTDDNDAALKIADFGFARSLQPRGLAETLC
GSPLYMAPEIMQLQKYDAKADLWSVGAILFQLVTGRTPFTGNSQIQLLQNIIRSTELHFP
ADCRDLSTDCKDLCQKLLRRNPVERLTFEEFFHHPFLSDKQSYDFTRSRLDSRTMNDFHS
SGSSPSRNIEEISQEDGLPFFLDDDSSGPEGSPSSFKHTSPMKSSYGFSVERREAALSPL
KNMDLSSRYSRVSHRAETNNFKFEGHRLSDRSQFKPSSLPDSRSFSTQGRVGDSPDSMDQ
DYVLISGPPVDIPSSSSGSPKPFNYPFKSHSPPVEFIKRNVTNLTAPMPIASATGNNLSR
FGSLESQNCIPGTSHGSLDLVDAFEQPSTNSLTRIRSLQKCAAAIAELVHERGENGKHLE
AFSIQLVILAIWNQALHICHTQAVSGIEGSLLQDINRVGRNISHGGSEKLLPQIQKEFVQ
EVERAEELAKFVESDNAKMPDAMEMILQAALALGISGGVDEVMGDAENAGNLYSKAVRLL
VFLAVEAQTLILNPPLTLTNSVRYRLRTYIDSLITRLKHLQSHRRTSYPQKQ

www.000webhost.com

Other information
Ka divergence:0.0496865KaKs divergence:0.0780591
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):2202Length 2 (bp):2139Length divergence:-0.015
MFE 1 (kcal):-665.43MFE 2 (kcal):-631.68MFE divergence-0.026