Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G37890-AT3G53940
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Mitochondrial substrate carrier family protein
Function (paralog2):Mitochondrial substrate carrier family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.64776735129501
Log2 mRNA fold difference:0.42772551337601
Log2 TE fold difference:0.0024450974529117
Sequences
Protein sequence

MNVDARVGVAVDGAQSALNTATTVHSSVVMTQIKPQAKLGTFQNLLAGGIAGAISKTCTA
PLARLTILFQLQGMQSEGAVLSRPNLRREASRIINEEGYRAFWKGNLVTVVHRIPYTAVN
FYAYEKYNLFFNSNPVVQSFIGNTSGNPIVHFVSGGLAGITAATATYPLDLVRTRLAAQR
NAIYYQGIEHTFRTICREEGILGLYKGLGATLLGVGPSLAINFAAYESMKLFWHSHRPND
SDLVVSLVSGGLAGAVSSTATYPLDLVRRRMQVEGAGGRARVYNTGLFGTFKHIFKSEGF
KGIYRGILPEYYKVVPGVGIVFMTYDALRRLLTSLPD

MEARVGVVVEGGQRALNTATTTAVHNTVVDAGNRKLLQQQPQTQQTQSCHQHHQSNKQSL
NQQQGHFGTVERLLAGGIAGAFSKTCTAPLARLTILFQIQGMQSEAAILSSPNIWHEASR
IVKEEGFRAFWKGNLVTVAHRLPYGAVNFYAYEEYKTFLHSNPVLQSYKGNAGVDISVHF
VSGGLAGLTAASATYPLDLVRTRLSAQRNSIYYQGVGHAFRTICREEGILGLYKGLGATL
LGVGPSLAISFAAYETFKTFWLSHRPNDSNAVVSLGCGSLSGIVSSTATFPLDLVRRRMQ
LEGAGGRARVYTTGLFGTFKHIFKTEGMRGLYRGIIPEYYKVVPGVGIAFMTFEELKKLL
STVPN

www.000webhost.com

Other information
Ka divergence:-0.416466KaKs divergence:0.265959
GC content 1 (%):44GC content 2 (%):46GC content divergence:0.022
Length 1 (bp):1014Length 2 (bp):1098Length divergence:0.04
MFE 1 (kcal):-326.8MFE 2 (kcal):-345.72MFE divergence0.028