Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G37900-AT3G53960
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Major facilitator superfamily protein
Function (paralog2):Major facilitator superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.1967483006624
Log2 mRNA fold difference:2.3504806816144
Log2 TE fold difference:-1.1610619806404
Sequences
Protein sequence

MEHKNIGAEVLQDTYDDQQKWVLDSSLDSRGRVPLRARTGAWRAALFIIAIEFSERLSYF
GLATNLVVYLTTILNQDLKMAIRNVNYWSGVTTLMPLLGGFIADAYLGRYATVLVATTIY
LMGLVLLTMSWFIPGLKPCHQEVCVEPRKAHEVAFFIAIYLISIGTGGHKPSLESFGADQ
FDDDHVEERKMKMSFFNWWNVSLCAGILTAVTAVAYIEDRVGWGVAGIILTVVMAISLII
FFIGKPFYRYRTPSGSPLTPILQVFVAAIAKRNLPYPSDPSLLHEVSKTEFTSGRLLCHT
EHLKFLDKAAIIEDKNPLALEKQSPWRLLTLTKVEETKLIINVIPIWFSTLAFGICATQA
STFFIKQAITMDRHIGGFTVPPASMFTLTALTLIISLTVYEKLLVPLLRSITRNQRGINI
LQRIGTGMIFSLITMIIAALVEKQRLDRTNNNKPMSVIWLAPQFMVIGFADAFTLVGLQE
YFYHQVPDSMRSLGIAFYLSVIGAASFLNNLLITAVDTLAENFSGKSWFGKDLNSSRLDR
FYWFLAGVIAANICVFVIVAKRCPYKSVQPSQGLS

MEHNKVDTEPQDSYDDQQKWVLDSSTDSRGEIPLRAQTGAWRAALFIIGIEFSERLSYFG
ISTNLVVYLTTILHQDLKMAVKNTNYWSGVTTLMPLLGGFVADAYLGRYGTVLLATTIYL
MGLILLTLSWFIPGLKACHEDMCVEPRKAHEIAFFIAIYLISIGTGGHKPSLESFGADQF
EDGHPEERKMKMSYFNWWNAGLCAGILTAVTVIVYIEDRIGWGVASIILTIVMATSFFIF
RIGKPFYRYRAPSGSPLTPMLQVFVAAIAKRNLPCPSDSSLLHELTNEEYTKGRLLSSSK
NLKFLDKAAVIEDRNENTKAEKQSPWRLATVTKVEEVKLLINMIPIWFFTLAFGVCATQS
STLFIKQAIIMDRHITGTSFIVPPASLFSLIALSIIITVTIYEKLLVPLLRRATGNERGI
SILQRIGVGMVFSLFAMIIAALIEKKRLDYAKEHHMNKTMTLSAIWLAPQFLVLGVADAF
TLVGLQEYFYDQVPDSMRSLGIAFYLSVLGAASFVNNLLITVSDHLAEEISGKGWFGKDL
NSSRLDRFYWMLAALTAANICCFVIVAMRYTYKTVQPSLAVVADGGDDVETATGTNNTSK
FT

Other information
Ka divergence:0.05136KaKs divergence:-0.273507
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1728Length 2 (bp):1809Length divergence:0.023
MFE 1 (kcal):-518.89MFE 2 (kcal):-552.14MFE divergence0.031