Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G37940-AT3G54020
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Arabidopsis Inositol phosphorylceramide synthase 2
Function (paralog2):Arabidopsis Inositol phosphorylceramide synthase 1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.8505616879218
Log2 mRNA fold difference:-2.1305982218167
Log2 TE fold difference:0.31839036554223
Sequences
Protein sequence

MTLYIRRESSKLWKRFCSEISTEIGLLAENWKYLLAGLICQYIHGLAAKGVHYIHRPGPT
LQDLGFFLLPELGQERSYISETVFTSVFLSFFLWTFHPFILKTKKIYTVLIWCRVLAFLV
ACQFLRVITFYSTQLPGPNYHCREGSKVSRLPWPKSALEVLEINPHGVMYGCGDLIFSSH
MIFTLVFVRTYQKYGTKRFIKLFGWLTAIVQSLLIIASRKHYSVDVVVAWYTVNLVVFCL
DKKLPELPDRTAVLLPVISKDRTKEENHKLLNGNGVDPADWRPRAQVNGKIDSNGVHTDN
TMNGA

MTLYIRREASKLWRRFCSEITTEIGLLAENWKYLLAGLLCQYIHGLAARGVHYIHRPGPT
LQDSGFFVLPELGQDKGFISETVFTCVFLSFFLWTFHPFIVKSKKIYTVLIWCRVLAFLV
ACQFLRVITFYSTQLPGPNYHCREGSELARLPRPHNVLEVLLLNFPRGVIYGCGDLIFSS
HMIFTLVFVRTYQKYGSKRFIKLLGWVIAILQSLLIIASRKHYTVDVVVAWYTVNLVVFF
LDKKLPELPDRTTALLPVISKDRTKEESHKLLNGNGVDPADRRPRAQVNGKDSNGGHTDN
ATNGT

www.000webhost.com

Other information
Ka divergence:-0.0591347KaKs divergence:-0.00199601
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):918Length 2 (bp):918Length divergence:0
MFE 1 (kcal):-277.5MFE 2 (kcal):-260.18MFE divergence-0.032