Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G37960-AT3G54060
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.98286427318115
Log2 mRNA fold difference:-0.45289201508806
Log2 TE fold difference:-0.21670112432503
Sequences
Protein sequence

MARSNRSKTSERIIGNGEVTPIQVAFLVDRYLCDNRFSKTRSLFRSEASSLISNSPVREV
PNSLLPLNEILNEYIRLKKEKIVMDQEKSKLDQEKTRVQNLLNGMQDVMNAYNSSTAAAP
PPPPVITSAAPMDKQVVASTSKQNNFGVSSSGCTVYNTQNAMTVSLPGNKRVGNFTGPCI
TQSITKKRKSPEVSVGAPSVSRKGMKKIPQAANYLTFQTPSEMQTPLNNGVATNESSDLT
SSVAKCLFDKSGTSPPSNSTCPRTPQQKVSPQSDKEVTPTNCTIVTKERITVSPLKQIAS
YTVERSHTVSSFSPVKSNLKMSSKRDHVKGRLNFDDTEATMHLDAPATVDMVSTSSSGSE
AEADLFDIDFSNIDLLSEDFSFSELLFDFDIGCEEMSNHSLPQPSNFHIETASGSSPESR
NTNLEPDQVVSEYTSTVTEMIQGKDMNTQGSDSMTTVKSITKCLRILSPAKNCRQRVTLD

MGKSSRSKGSNLIGKGEVTPTQVAFIVDRYLHDNRFSETRALFRSEASSLISDSPIRNVP
NSLMTLDAMLNHYVSLKKQKVSLDQEKLKLDQEKIRVQNLLQGMENVMNTYNASLTAPPP
ASAPTSQQKNHSISSSGLSQYNTLNGMSVSLLGNKRVDFGNFSTPSTSQSITGKRKGPEV
SVTAPPVSRKSRITRATGTNKLPQADKAANNFTSETLAVAKNSASNELIGNGSSVVKCLF
NKADSSVPTSSTCFRTPQKHASSGSDKSNSSQKEVTPTNTNCTIVTKERFTISPLKQITS
YSVERSHLISFSSPVKSNLKMSNKRDHVKGKLNFDDTDTETCLEAPATADLVSTSPSGSE
PEVDLFDMDFSNLDFSELLVDFDLGCEGSANHCLSLTPNQPTQTVSGSSPESGDCNLESD
QPFLEYTSTVTDVIQISRCIDPLSNSSHSSLNTDKI

www.000webhost.com

Other information
Ka divergence:0.194617KaKs divergence:0.295935
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):1443Length 2 (bp):1371Length divergence:-0.026
MFE 1 (kcal):-373.6MFE 2 (kcal):-373.28MFE divergence0