Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G38210-AT2G38230
Species:Arabidopsis
Duplication type:TD
Function (paralog1):putative PDX1-like protein 4
Function (paralog2):pyridoxine biosynthesis 1.1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.97891813505457
Log2 mRNA fold difference:-0.52915953748474
Log2 TE fold difference:-0.47462863701374
Sequences
Protein sequence

MAGTGVVAVYGEGAMTETKQKSPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVM
ALERVPADIRAQGGVARFC

MAGTGVVAVYGEGAMTETKQKSPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVM
ALERVPADIRAQGGVARMSDPEMIKEIKNAVTIPVMAKARIGHFVEAQILEAIGVDYVDE
SEVLTLADEDNHINKHNFKIPFVCGCRNLGEALRRIREGAAMIRTKGEAGTGNVVEAVRH
VRSVNGAIRLLRSMDDDEVFTYAKKIAAPYDLVVQTKELGRLPVVQFAAGGVATPADAAL
MMQLGCDGVFVGSGVFKSGDPVKRAKAIVQAVTNYRDAAVLAEVSCGLGEAMVGLNLDDK
VERFASRSE

www.000webhost.com

Other information
Ka divergence:-1KaKs divergence:-1
GC content 1 (%):55GC content 2 (%):50GC content divergence:-0.048
Length 1 (bp):240Length 2 (bp):930Length divergence:0.59
MFE 1 (kcal):-85.16MFE 2 (kcal):-334.9MFE divergence0.595